PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast02G333900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family LBD
Protein Properties Length: 146aa    MW: 16076.2 Da    PI: 7.3415
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast02G333900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260120.31.1e-37101091100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaCk+lrr+Ca+dCvlap+fpa++p+++a+v+++FGa nv ++l++lp eer++a++++v eA  ra+dPvyG++gvi++lq++++ ++
  Brast02G333900.1.p  10 RCAACKYLRRRCARDCVLAPHFPASDPQRYACVQRFFGAGNVARMLQQLPAEERRAAADAMVVEASRRAQDPVYGCAGVIHSLQEEIRAVQ 100
                         6****************************************************************************************** PP

              DUF260  92 aelallkee 100
                          ela++++e
  Brast02G333900.1.p 101 CELARTRAE 109
                         ****99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.7549110IPR004883Lateral organ boundaries, LOB
PfamPF031951.6E-3610107IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016020Cellular Componentmembrane
Sequence ? help Back to Top
Protein Sequence    Length: 146 aa     Download sequence    Send to blast
MSDTEGNPRR CAACKYLRRR CARDCVLAPH FPASDPQRYA CVQRFFGAGN VARMLQQLPA  60
EERRAAADAM VVEASRRAQD PVYGCAGVIH SLQEEIRAVQ CELARTRAEI AMHQATTAAT  120
SRLPFQPEDD DQQMLIELHG GFLSG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-2941105111LOB family transfactor Ramosa2.1
5ly0_B3e-2941105111LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast02G333900.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003559344.13e-73LOB domain-containing protein 24
SwissprotP594681e-46LBD24_ARATH; LOB domain-containing protein 24
TrEMBLA0A0Q3J4B97e-72A0A0Q3J4B9_BRADI; Uncharacterized protein
STRINGOGLUM03G36620.11e-51(Oryza glumipatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP52823562
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.15e-49LOB domain-containing protein 24