PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast02G279300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GeBP
Protein Properties Length: 383aa    MW: 41125.8 Da    PI: 5.9419
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast02G279300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573864.8e-2786180297
              DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifels 92 
                         +fqr+wse+De+ +LqGl+ +   +g     d++ fy+ +++s+   +++sql+eK+rrLK+K++  ++++++g +p+  ++hd+++++l+
  Brast02G279300.1.p  86 KFQRIWSESDELRFLQGLLGC-GAQGLVFPRDLNVFYDRFSESMPQPYTRSQLSEKLRRLKNKYRSVSTRVARGLDPARLAPHDRDVLHLC 175
                         79*******************.556878888************************************************************ PP

              DUF573  93 kkiWg 97 
                         +++W+
  Brast02G279300.1.p 176 SRLWD 180
                         ****8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.3E-2487180IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 383 aa     Download sequence    Send to blast
MASDQTLPPL PLLPAPSNTN QIPDPTAPLP DPTPPASAAR KLPIKRRSPP RPSSSPSSSG  60
PASSGDPLKH PNPRRPDQDD GQPPFKFQRI WSESDELRFL QGLLGCGAQG LVFPRDLNVF  120
YDRFSESMPQ PYTRSQLSEK LRRLKNKYRS VSTRVARGLD PARLAPHDRD VLHLCSRLWD  180
PANAATSPFA ASAGSPGNKR RRAAPLEVPP PSGDGNSHDY NGTSSATPGP GAFMDGNGED  240
VMYLEQESGH LYYDQGAALA ANGSLDGFTM EQAETVAALT NTGGNGVGME IAPQSIENTG  300
VGSQNGNCTV MIPRSSEHCM ASDVLDVFEE CLREAKADGT ICGGNAEESE LAKRWRAQRI  360
DELDVLSRRL RLLIEDAGAA RH*
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast02G279300.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0944721e-153FP094472.1 Phyllostachys edulis cDNA clone: bphylf057n04, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010231034.10.0probable transcription factor At5g28040
TrEMBLI1GP540.0I1GP54_BRADI; Uncharacterized protein
STRINGBRADI1G11200.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP86953243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04930.25e-12DNA-binding storekeeper protein-related transcriptional regulator