PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast02G259700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family HB-other
Protein Properties Length: 275aa    MW: 30615.5 Da    PI: 8.1042
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast02G259700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.84.4e-091922252255
                         SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
            Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                         ++yps+ e++ LA+++gL+ +q+ +WF N+R ++
  Brast02G259700.1.p 192 SPYPSELEKAALAESTGLDRKQINNWFINQRKRH 225
                         79*****************************885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512575126No hitNo description
SMARTSM012552.2E-17448IPR005540KNOX1
PfamPF037901.2E-18542IPR005540KNOX1
SMARTSM012563.4E-2552103IPR005541KNOX2
PfamPF037915.9E-1958100IPR005541KNOX2
PROSITE profilePS5007113.831165228IPR001356Homeobox domain
SMARTSM003895.3E-11167232IPR001356Homeobox domain
SuperFamilySSF466891.28E-16167234IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.7E-22170229IPR009057Homeodomain-like
CDDcd000865.34E-12179228No hitNo description
PfamPF059203.1E-15185224IPR008422Homeobox KN domain
PROSITE patternPS000270203226IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
MGTDAMKAKI MLHPLYPALL GAFIGCQKVG APPEVVGRLS SLSDDLKSNS DDVLEQPADP  60
ELDQFMETYC DMLVTYSQEL TRQIQEADHF FRNMEAHISS STLANGGGNC EGRVSSEDEQ  120
EISDVGGLPV RAAAITGPFG EGKEPIDQFL NKHSDYLSSL WRKLSRKKKK KGKLPSGERQ  180
KLLQWWRLNW RSPYPSELEK AALAESTGLD RKQINNWFIN QRKRHWKPTP PAMELLHGRT  240
KQQHHYGASS SSSAAFLTEG HYFTGGSAYP PRGP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1161170RKLSRKKKKK
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast02G259700.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014755813.11e-140homeobox protein knotted-1-like 4
SwissprotQ75LX71e-103KNOS4_ORYSJ; Homeobox protein knotted-1-like 4
TrEMBLI1GPN41e-140I1GPN4_BRADI; Uncharacterized protein
STRINGBRADI1G12677.11e-141(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47462950
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.13e-59KNOTTED-like from Arabidopsis thaliana