PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast02G254000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family LBD
Protein Properties Length: 182aa    MW: 19632.6 Da    PI: 8.6945
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast02G254000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260140.46e-44181171100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaCk+lrr+Ca++Cv+apyfp+++p++fa vhk+FGasn+ kll+++p e+r da+sslvyeA+ar+rdP+yG+vg i++lq+q+e+l+
  Brast02G254000.1.p  18 PCAACKLLRRRCAAGCVFAPYFPSSEPHRFASVHKVFGASNLNKLLQEVPAEHRGDAVSSLVYEANARMRDPIYGCVGAISSLQRQVESLQ 108
                         7****************************************************************************************** PP

              DUF260  92 aelallkee 100
                         ++lal+++e
  Brast02G254000.1.p 109 TQLALAQAE 117
                         *****9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.90717118IPR004883Lateral organ boundaries, LOB
PfamPF031953.1E-4318115IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 182 aa     Download sequence    Send to blast
MKDVVVVAAG GRAQPTPPCA ACKLLRRRCA AGCVFAPYFP SSEPHRFASV HKVFGASNLN  60
KLLQEVPAEH RGDAVSSLVY EANARMRDPI YGCVGAISSL QRQVESLQTQ LALAQAEMIR  120
LKMGNACAAR RGSSAGGSPS SSMSPEVARD CKPTADLARM VVEHQPNMME MELEYSRFWS  180
F*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A5e-481812511118LOB family transfactor Ramosa2.1
5ly0_B5e-481812511118LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast02G254000.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0699111e-100BT069911.1 Zea mays full-length cDNA clone ZM_BFb0321D10 mRNA, complete cds.
GenBankKJ7276501e-100KJ727650.1 Zea mays clone pUT5577 LOB transcription factor (LOB19) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010229521.11e-113LOB domain-containing protein 4
SwissprotQ8LBW32e-52LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A0Q3GSR81e-111A0A0Q3GSR8_BRADI; Uncharacterized protein
STRINGTraes_4BS_E9E0C550B.17e-81(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP88238150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G16530.18e-45ASYMMETRIC LEAVES 2-like 9
Publications ? help Back to Top
  1. Penfield S, et al.
    Reserve mobilization in the Arabidopsis endosperm fuels hypocotyl elongation in the dark, is independent of abscisic acid, and requires PHOSPHOENOLPYRUVATE CARBOXYKINASE1.
    Plant Cell, 2004. 16(10): p. 2705-18
    [PMID:15367715]