PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast02G232800.4.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family LBD
Protein Properties Length: 280aa    MW: 30423.2 Da    PI: 7.32
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast02G232800.4.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.22.5e-4271061100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaCk+lrrkC+++Cv+apyfp +qp++fanvhk+FGasnv+kll++lp+ +reda++sl+yeAear+rdPvyG+v+ i+ lq++++ ++
  Brast02G232800.4.p   7 PCAACKLLRRKCTQGCVFAPYFPPDQPSRFANVHKVFGASNVSKLLNELPQAQREDAVNSLAYEAEARLRDPVYGCVAYISILQHRIKMVR 97 
                         7****************************************************************************************** PP

              DUF260  92 aelallkee 100
                         +e++ +++e
  Brast02G232800.4.p  98 EEIVNTRKE 106
                         ***999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.6916107IPR004883Lateral organ boundaries, LOB
PfamPF031953.5E-427104IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009954Biological Processproximal/distal pattern formation
GO:0009965Biological Processleaf morphogenesis
GO:0048441Biological Processpetal development
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MSSSSSPCAA CKLLRRKCTQ GCVFAPYFPP DQPSRFANVH KVFGASNVSK LLNELPQAQR  60
EDAVNSLAYE AEARLRDPVY GCVAYISILQ HRIKMVREEI VNTRKELAGY IGQAAYAPFL  120
PAQQPHAAQF VPGMGLLQHP HQQHQQQMMV AMQQQQQQQA PYHHQQIVEA QHMAAAVEVA  180
ARGNQDMVMH HGFMPAAGGP TVAVVAPGSA HDAAAYEGGA QQFLIQQQQP HPNSAMTSYR  240
MEPSPPPQSS GHSHVDMPHH RQQHTDGSDE GSGGPPPPT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-4741108114LOB family transfactor Ramosa2.1
5ly0_B1e-4741108114LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast02G232800.4.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3681341e-125AK368134.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2068L23.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010232652.11e-152LOB domain-containing protein 36
TrEMBLI1GQB01e-150I1GQB0_BRADI; Uncharacterized protein
STRINGBRADI1G14677.11e-151(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.18e-62ASYMMETRIC LEAVES 2-like 1