PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast02G222300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family M-type_MADS
Protein Properties Length: 251aa    MW: 27681.5 Da    PI: 9.2063
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast02G222300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF30.25.8e-101050242
                        ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
              SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                         i+n s r  t  kR  g+ KK +EL +LC++e ++i+f +
  Brast02G222300.1.p 10 LISNASTRRSTQKKRGSGLTKKLSELLTLCGVEGCLIVFPE 50
                        59************************************966 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004327.4E-11163IPR002100Transcription factor, MADS-box
PROSITE profilePS5006614.409153IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.92E-17295IPR002100Transcription factor, MADS-box
CDDcd002666.60E-23288No hitNo description
PRINTSPR004043.6E-6323IPR002100Transcription factor, MADS-box
PfamPF003198.8E-111153IPR002100Transcription factor, MADS-box
PRINTSPR004043.6E-62338IPR002100Transcription factor, MADS-box
PRINTSPR004043.6E-63859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MTRKKTKIEL ISNASTRRST QKKRGSGLTK KLSELLTLCG VEGCLIVFPE GDKAAPPPQA  60
WPSEEAARRV IERLRAMPEL DQFRKMMDAE GFVRELIGKL QDQLRKAERD NRERETKLLL  120
HEVVAGRRPG GLAGLTIEQL VSVGWMSENL INKIRDRLAC HYQQRQHAAA ATTGAEQLQQ  180
QQQQQQQGWV MEVVKAGWDV DAAPAYSTGS ASGSGGSYGG EVMMPQQFPG FDAGSFQQWA  240
DPGTSNFPPM *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11622RRSTQKK
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast02G222300.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4693500.0KF469350.1 Brachypodium distachyon MADS-box transcription factor 56 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001289792.11e-132uncharacterized LOC100825352
RefseqXP_024314125.11e-132uncharacterized LOC100825352 isoform X1
TrEMBLA0A0Q3KTA71e-135A0A0Q3KTA7_BRADI; Uncharacterized protein
STRINGBRADI1G15480.11e-132(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36336202
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.15e-29AGAMOUS-like 80