PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast02G217500.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family HB-other
Protein Properties Length: 1280aa    MW: 144668 Da    PI: 8.8182
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast02G217500.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox40.83.8e-13169220657
                         S--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
            Homeobox   6 tftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                         + ++ q++ Le+++ + +yp+ +++ e A+++gL  +qV++WF+ rR ke++
  Brast02G217500.2.p 169 KKSPLQIQMLERFYSEVQYPKPDDMIEYASSVGLAYSQVRIWFKERRRKERR 220
                         66899*********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007113.847161221IPR001356Homeobox domain
SMARTSM003893.4E-14163225IPR001356Homeobox domain
SuperFamilySSF466892.61E-12167227IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.3E-14168229IPR009057Homeodomain-like
CDDcd000862.79E-7168211No hitNo description
PfamPF000461.8E-10169220IPR001356Homeobox domain
SMARTSM005713.2E-4498557IPR018501DDT domain
PROSITE profilePS5082710.06498557IPR018501DDT domain
PfamPF027916.4E-7500552IPR018501DDT domain
PfamPF156122.3E-5777808IPR028942WHIM1 domain
PfamPF156131.2E-9900971IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1280 aa     Download sequence    Send to blast
MRPSSAMTHL CARAYNSCVV RMWIASRTLR VEETYLEGEV SDWKTTSLTQ TITDSHSNPD  60
LNPSRHPFRR LAGVAGSQRP RARVVSARRL LLTANARRPQ STSRRRRDCS RHPLQARPSS  120
RAWHSQLTRP SRRWRWQSAR QRQLKDGTNW NIFFVTVVLV QMMTNAGTKK SPLQIQMLER  180
FYSEVQYPKP DDMIEYASSV GLAYSQVRIW FKERRRKERR QMEAAGAHME TQVSARSNGP  240
RSMSLVGEKH ALRPQVLYPK DYILAKVFRK DGPSLGSEFD PLPKSAHGHV RDTTEYHSDQ  300
DQRVVKKRKI VECTDQGFTL PCQSNGPVRK HGMGKGLMTV WHAMYSKNAE VQDVSNFIDE  360
TGCLRSLRPF DDSDGKLIQK KISPRKKVDK KSRPPPSKRK VPRGRVTVLK EHPPMECHLS  420
VDESESSELQ TEQATLVDDE ELELSELQAG PNPLRCSAHL SSSGRHGCPL CKDLLARFPP  480
PSVKMKQPFS TKPWDSSPEM VKKLFQVVRF VYTHFGSMDV HPFTFDEFAQ AFHDKESSLL  540
GKVHVSLLKL LLLSTKRDSG DVFVPRSSKD SRFISFLNFV REQEFDVNFW IKSLNSLTWV  600
EILRQVLVAS GFGSDHHMLN RNFFIKEKNQ MVKYGLRPRT LKGELFALLS KKGIRGLKVS  660
ELAKSPQIVD LNLSGASEVE QLIFSTLSSD ITLFEKIASS AYRLRVDPRI KGKENPKSDT  720
EDSGTVDDDE DASSSGEEYD GPEELSFSEH ECRIVRRKQK NGHKTMNKCS EIDESYSGER  780
WLLGLMEGEY SDLSIDEKLD CLVALMDVVS GAGSVPRLEE PQSVLSNIQR AQSHASGGKI  840
KKLRRTIYQS SDEYLNRPGS SHSFDTSIQG QSGNRRSQDY ISESAANESS TGFAHQPQIV  900
LLGSDRRYNN YWLFLGPCTA DDPGHRRVYF ESSEDGHWEV LDSPQELLSL LSLLDIRGRR  960
EAHLLASMKK RQACLFEGMK KHLEDGNAVG ISASSDSSRS ETSSGSRASP KLGSGDGASP  1020
LSDIDNASVP TYLADNLLSA SSAIVIEAGR RGDEKILKWE RLQALDKWIW TSFYSSLIAV  1080
KCGKRSFKES LVHCESCHDL YWRDEKHCRI CHSTFEVGFD LEERYAIHVA TCREPEDLYD  1140
VPNHKVLSSQ LQALKAAIHA IEACMPEAAF AGLWMKSSHN LWVRRLRRTS SLPELLQVLV  1200
DFVGAMDEDW LYQSSSTVSF CSYLDNITVY FQTMPQTTSA VALWVVKLDA LIAPYLVQTD  1260
PDRALAEGST KTRTQACVR*
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast02G217500.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3739810.0AK373981.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3049P02.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014758747.10.0homeobox-DDT domain protein RLT3 isoform X2
TrEMBLA0A0Q3IIR90.0A0A0Q3IIR9_BRADI; Uncharacterized protein
STRINGMLOC_6327.30.0(Hordeum vulgare)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G12750.10.0Homeodomain-like transcriptional regulator