PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast02G217500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family HB-other
Protein Properties Length: 1282aa    MW: 144838 Da    PI: 8.8182
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast02G217500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox40.83.8e-13169220657
                         S--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
            Homeobox   6 tftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                         + ++ q++ Le+++ + +yp+ +++ e A+++gL  +qV++WF+ rR ke++
  Brast02G217500.1.p 169 KKSPLQIQMLERFYSEVQYPKPDDMIEYASSVGLAYSQVRIWFKERRRKERR 220
                         66899*********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007113.847161221IPR001356Homeobox domain
SMARTSM003893.4E-14163225IPR001356Homeobox domain
SuperFamilySSF466892.61E-12167227IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.3E-14168229IPR009057Homeodomain-like
CDDcd000862.60E-7168211No hitNo description
PfamPF000461.8E-10169220IPR001356Homeobox domain
SMARTSM005713.2E-4500559IPR018501DDT domain
PROSITE profilePS5082710.06500559IPR018501DDT domain
PfamPF027916.4E-7502554IPR018501DDT domain
PfamPF156122.3E-5779810IPR028942WHIM1 domain
PfamPF156131.2E-9902973IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1282 aa     Download sequence    Send to blast
MRPSSAMTHL CARAYNSCVV RMWIASRTLR VEETYLEGEV SDWKTTSLTQ TITDSHSNPD  60
LNPSRHPFRR LAGVAGSQRP RARVVSARRL LLTANARRPQ STSRRRRDCS RHPLQARPSS  120
RAWHSQLTRP SRRWRWQSAR QRQLKDGTNW NIFFVTVVLV QMMTNAGTKK SPLQIQMLER  180
FYSEVQYPKP DDMIEYASSV GLAYSQVRIW FKERRRKERR QMEAAGAHME TQVSARSNGP  240
RSMSLVGEKH ALRPQVLYPK DYILAKVFRK DGPSLGSEFD PLPKSAHGHV RVADTTEYHS  300
DQDQRVVKKR KIVECTDQGF TLPCQSNGPV RKHGMGKGLM TVWHAMYSKN AEVQDVSNFI  360
DETGCLRSLR PFDDSDGKLI QKKISPRKKV DKKSRPPPSK RKVPRGRVTV LKEHPPMECH  420
LSVDESESSE LQTEQATLVD DEELELSELQ AGPNPLRCSA HLSSSGRHGC PLCKDLLARF  480
PPPSVKMKQP FSTKPWDSSP EMVKKLFQVV RFVYTHFGSM DVHPFTFDEF AQAFHDKESS  540
LLGKVHVSLL KLLLLSTKRD SGDVFVPRSS KDSRFISFLN FVREQEFDVN FWIKSLNSLT  600
WVEILRQVLV ASGFGSDHHM LNRNFFIKEK NQMVKYGLRP RTLKGELFAL LSKKGIRGLK  660
VSELAKSPQI VDLNLSGASE VEQLIFSTLS SDITLFEKIA SSAYRLRVDP RIKGKENPKS  720
DTEDSGTVDD DEDASSSGEE YDGPEELSFS EHECRIVRRK QKNGHKTMNK CSEIDESYSG  780
ERWLLGLMEG EYSDLSIDEK LDCLVALMDV VSGAGSVPRL EEPQSVLSNI QRAQSHASGG  840
KIKKLRRTIY QSSDEYLNRP GSSHSFDTSI QGQSGNRRSQ DYISESAANE SSTGFAHQPQ  900
IVLLGSDRRY NNYWLFLGPC TADDPGHRRV YFESSEDGHW EVLDSPQELL SLLSLLDIRG  960
RREAHLLASM KKRQACLFEG MKKHLEDGNA VGISASSDSS RSETSSGSRA SPKLGSGDGA  1020
SPLSDIDNAS VPTYLADNLL SASSAIVIEA GRRGDEKILK WERLQALDKW IWTSFYSSLI  1080
AVKCGKRSFK ESLVHCESCH DLYWRDEKHC RICHSTFEVG FDLEERYAIH VATCREPEDL  1140
YDVPNHKVLS SQLQALKAAI HAIEACMPEA AFAGLWMKSS HNLWVRRLRR TSSLPELLQV  1200
LVDFVGAMDE DWLYQSSSTV SFCSYLDNIT VYFQTMPQTT SAVALWVVKL DALIAPYLVQ  1260
TDPDRALAEG STKTRTQACV R*
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast02G217500.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3739810.0AK373981.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3049P02.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010237104.10.0homeobox-DDT domain protein RLT3 isoform X1
TrEMBLA0A0Q3IIR90.0A0A0Q3IIR9_BRADI; Uncharacterized protein
STRINGMLOC_6327.30.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP45563350
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G12750.10.0Homeodomain-like transcriptional regulator