PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast02G172000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family bZIP
Protein Properties Length: 358aa    MW: 38431.8 Da    PI: 6.931
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast02G172000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_129.91.2e-09161208552
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 
                         kr++r   NR +A rs +RK  ++ eLe+kv++L++e ++L  +l   
  Brast02G172000.1.p 161 KRAKRILANRQSAARSKERKARYMTELERKVQTLQTEATTLSAQLTLF 208
                         9****************************************9888765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.5E-14157221IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.611159222IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.21E-10161212No hitNo description
Gene3DG3DSA:1.20.5.1702.2E-8161215No hitNo description
PfamPF001701.8E-8161206IPR004827Basic-leucine zipper domain
CDDcd147032.04E-21162211No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MQQPKPADPP ARPFPPPSPA MAAAATAMRG AHHRRARSEV AFRLPDDLDL GSAGDGDGSA  60
GFDEIGSEDD LFSTFMDIEK ISSGPAAAAA GSDRDRAAET SSPPRPKHRY SSSVDGSGLF  120
SAGGSAARKD AAAAQALADV LEAKKAMSPE QLAELAAIDP KRAKRILANR QSAARSKERK  180
ARYMTELERK VQTLQTEATT LSAQLTLFQR DTTGLSAENA ELKIRLQAME QQAQLRDALN  240
DALKQEVERL KMATGEMSNS NDTYSMGLQH VLYNSSFFPQ SQQNTPQHQG SARFPPPFHP  300
PHPNVPNHQM LSHPNTLSDV MQQDHLARLQ GLDIGKGHPV VKSESSSISA SESSSTF*
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor probably involved in vascular development and shoot tissue organization. Binds to the DNA sequence 5'-CCGAGTGTGCCCCTGG-3' present in the promoter region Box II of the phloem-specific rice tungro bacilliform virus (RTBV) promoter. May regulate tissue-specific expression of the RTBV promoter and virus replication. {ECO:0000269|PubMed:14704272}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00303DAPTransfer from AT2G40620Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast02G172000.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3692850.0AK369285.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2088F01.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003557964.10.0transcription factor RF2b
SwissprotQ6S4P41e-168RF2B_ORYSJ; Transcription factor RF2b
TrEMBLI1H5R30.0I1H5R3_BRADI; Uncharacterized protein
STRINGBRADI1G63170.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26833683
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40620.19e-75bZIP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Dai S,Zhang Z,Bick J,Beachy RN
    Essential role of the Box II cis element and cognate host factors in regulating the promoter of Rice tungro bacilliform virus.
    J. Gen. Virol., 2006. 87(Pt 3): p. 715-22
    [PMID:16476995]
  3. Liu Y,Dai S,Beachy RN
    Role of the C-terminal domains of rice (Oryza sativa L.) bZIP proteins RF2a and RF2b in regulating transcription.
    Biochem. J., 2007. 405(2): p. 243-9
    [PMID:17371296]
  4. Dai S, et al.
    Transgenic rice plants that overexpress transcription factors RF2a and RF2b are tolerant to rice tungro virus replication and disease.
    Proc. Natl. Acad. Sci. U.S.A., 2008. 105(52): p. 21012-6
    [PMID:19104064]