PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast02G167900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family G2-like
Protein Properties Length: 450aa    MW: 49322.4 Da    PI: 6.3514
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast02G167900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.47.5e-34232286155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         k+r+rWtpeLHe+Fv+av++LGGsekAtPk +l+lmkv++Lt++hvkSHLQkYR+
  Brast02G167900.1.p 232 KQRMRWTPELHECFVDAVNKLGGSEKATPKGVLKLMKVDSLTIYHVKSHLQKYRT 286
                         79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.488229289IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-31230288IPR009057Homeodomain-like
SuperFamilySSF466896.27E-18231286IPR009057Homeodomain-like
TIGRFAMsTIGR015577.7E-26232286IPR006447Myb domain, plants
PfamPF002491.4E-9234285IPR001005SANT/Myb domain
PfamPF143792.2E-24315361IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 450 aa     Download sequence    Send to blast
MRKCDLRHSH NNRVSGAMSS SLPILPNSLK ENFPRSHNPQ LIPMPRQLMN GSVPLHSAPQ  60
SATLHPRAGV MPSSYSASLG FSASPADSVP NHESQSMPAP FISQPLDIEL FQTLSDNISG  120
GHTEETWFPG SVDGLTDYGD NVGAPGNQIQ NNSPAVTSDV VAKQNEWWEE IMDDDWRGIL  180
DATTTDSQSK AMVQTSNSAV SQPAVNQSAS SHSAEMCNVA SPPNGNNVSA AKQRMRWTPE  240
LHECFVDAVN KLGGSEKATP KGVLKLMKVD SLTIYHVKSH LQKYRTARYK PDLSEGTTEK  300
RTTTEELTLD LKSSMDLTEA LRLQMEVQKR LHEQLETQRK LQLRIEEQGK YLQMMFEKQS  360
KSSTENVQDL SGNTAAPSSD PNHSVNRDSE AAEDPNRTGD NPGSVKSGES STHTRGNQRT  420
AERDSSDPLA NTNDGSKAPQ EKRRRLHDS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A5e-29231290160Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B5e-29231290160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A5e-29231290160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C5e-29231290160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D5e-29231290160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F5e-29231290160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H5e-29231290160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J5e-29231290160Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1441445KRRRL
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in phosphate starvation signaling. Binds to P1BS, an imperfect palindromic sequence 5'-GNATATNC-3', to promote the expression of inorganic phosphate (Pi) starvation-responsive genes. Functionally redundant with PHR2 and PHR3 in regulating Pi starvation response and Pi homeostasis. {ECO:0000250|UniProtKB:Q10LZ1}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast02G167900.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010228678.10.0protein PHOSPHATE STARVATION RESPONSE 1
RefseqXP_024312499.10.0protein PHOSPHATE STARVATION RESPONSE 1
SwissprotB8ANX90.0PHR1_ORYSI; Protein PHOSPHATE STARVATION RESPONSE 1
TrEMBLI1H5W40.0I1H5W4_BRADI; Uncharacterized protein
STRINGBRADI1G63530.20.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19713789
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.15e-62phosphate starvation response 1