PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast02G103200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family WOX
Protein Properties Length: 162aa    MW: 18505.9 Da    PI: 8.2521
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast02G103200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.76.1e-2164124257
                         T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
            Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                         r+R+++t+ ql++Le+ F + n +p ++++++++++l    +++e++V++WFqNrRa+ k+
  Brast02G103200.1.p  64 RQRWAPTQMQLQILESIFDQgNGTPRKQKIKDITAELsqhgNISETNVYNWFQNRRARSKR 124
                         89*****************99**************************************97 PP

2Wus_type_Homeobox100.41.3e-3263126265
   Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                         ar+RW+Pt+ Q++iLe+++++G  tP k++i++itaeL+++G+i+++NV++WFQNr+aR+++k+
  Brast02G103200.1.p  63 ARQRWAPTQMQLQILESIFDQGNGTPRKQKIKDITAELSQHGNISETNVYNWFQNRRARSKRKK 126
                         789***********************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.0E-1658128IPR009057Homeodomain-like
PROSITE profilePS5007114.49560125IPR001356Homeobox domain
SMARTSM003891.3E-1162129IPR001356Homeobox domain
SuperFamilySSF466895.13E-1763127IPR009057Homeodomain-like
PfamPF000469.8E-1964124IPR001356Homeobox domain
CDDcd000868.95E-1264126No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 162 aa     Download sequence    Send to blast
MEVMTDEQME VLRKQISIYF TICEQIVGIH RTITSHQDSI AGMRLGNLYC DPLMVHGGHK  60
ITARQRWAPT QMQLQILESI FDQGNGTPRK QKIKDITAEL SQHGNISETN VYNWFQNRRA  120
RSKRKKSAFV PNNAESEAEA DEESPTEKKP KSDGPLHQNI W*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003564486.11e-95PREDICTED: WUSCHEL-related homeobox 8-like
SwissprotQ5QMM31e-90WOX8_ORYSJ; WUSCHEL-related homeobox 8
TrEMBLM0X0X04e-98M0X0X0_HORVD; Uncharacterized protein
STRINGMLOC_56124.21e-97(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38983776
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35550.14e-56WUSCHEL related homeobox 13