PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast02G073200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family HD-ZIP
Protein Properties Length: 313aa    MW: 33687.1 Da    PI: 4.7214
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast02G073200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.52.6e-1957108556
                         SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         +++  eq+++Le+ Fe +++++ e+++++A+ lgL+ rqV vWFqNrRa++k
  Brast02G073200.1.p  57 RRLALEQVRALERSFEVDNKLDPERKARIARDLGLQPRQVAVWFQNRRARWK 108
                         467789*********************************************9 PP

2HD-ZIP_I/II1283.8e-4155146293
         HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                         kkrrl+ eqv++LE+sFe ++kL+perK+++ar+LglqprqvavWFqnrRAR+ktkqlE+d++aL++++dal+++ ++L++++++L++e++
  Brast02G073200.1.p  55 KKRRLALEQVRALERSFEVDNKLDPERKARIARDLGLQPRQVAVWFQNRRARWKTKQLERDFSALRARHDALRNDCDALRRDKDALAAEIR 145
                         9**************************************************************************************9998 PP

         HD-ZIP_I/II  93 e 93 
                         e
  Brast02G073200.1.p 146 E 146
                         6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.55E-1950112IPR009057Homeodomain-like
SMARTSM003894.3E-1953114IPR001356Homeobox domain
CDDcd000866.98E-1855111No hitNo description
PROSITE profilePS5007116.61755110IPR001356Homeobox domain
PfamPF000461.2E-1657108IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.2E-1962109IPR009057Homeodomain-like
PRINTSPR000312.8E-58190IPR000047Helix-turn-helix motif
PROSITE patternPS00027085108IPR017970Homeobox, conserved site
PRINTSPR000312.8E-590106IPR000047Helix-turn-helix motif
PfamPF021838.5E-16110151IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MKRQSKRPTR GGQESPEPGE SLLAPYMEHD DAEFEEAEED EDEERGSLSC GLGGKKRRLA  60
LEQVRALERS FEVDNKLDPE RKARIARDLG LQPRQVAVWF QNRRARWKTK QLERDFSALR  120
ARHDALRNDC DALRRDKDAL AAEIRELREK LPKPETGAVK AEAGIEGELR QAPAVGNNNK  180
DGSSDSDSSV VFNDEASPCP YSGAAALEQP GGGGCFMGFG APAFLDSSAA TGGCSSSLLP  240
MLEAKWPAAY GSYDAGKGGG GYGFTEEWLA GTDAIGNDAG AGFFADEHVS SLNFGWCGSG  300
AEGFDLHGYC KK*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1102110RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast02G073200.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3539651e-122AK353965.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1004B20.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003558624.11e-180homeobox-leucine zipper protein HOX13
SwissprotQ10QP31e-101HOX13_ORYSJ; Homeobox-leucine zipper protein HOX13
TrEMBLI1H8S41e-178I1H8S4_BRADI; Uncharacterized protein
STRINGBRADI1G71930.11e-179(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42833170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65310.22e-35homeobox protein 5
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]