PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast02G024600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family bZIP
Protein Properties Length: 426aa    MW: 44899.1 Da    PI: 6.9666
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast02G024600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.96.1e-10280333558
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevak 58 
                         kr +r   NR +A rs +RK  +i eLe+kv+ L++e ++L  +l  l+  +a 
  Brast02G024600.1.p 280 KRVKRVLANRQSAARSKERKMRYIVELEQKVQMLQTEATTLSAQLTLLQRDSAG 333
                         999*****************************************9999887765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.3E-17276340IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.484278341IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.77E-11280330No hitNo description
PfamPF001705.4E-9280332IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.4E-10280332No hitNo description
CDDcd147032.80E-21281332No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 426 aa     Download sequence    Send to blast
MDSRVGEAAK LMQQQGMQPL SLPMAASSFA AEAAANKPRA AGLPPTPPFA SGGVLQRDVC  60
MEDSSSSAAA ALKAAHRRSR SDVPYGYPPS IMASSAMAMG ARLQPKTEWA QPQQHLGEGG  120
NGAFNGNGNG GDDLFNAYMN LEGLDALNAA AASSSPDSRG SSVKAESSDN DGYGSEEGAV  180
LRGALWADAN GNKRSAAAAG ELAAPAASVH ARHARSLSMD SLMGRLNFAS GAGASAAVAN  240
GAGGGSVFSL EFGSGEFTPV EMKKIMADER LAEMALADPK RVKRVLANRQ SAARSKERKM  300
RYIVELEQKV QMLQTEATTL SAQLTLLQRD SAGVATQNNE LRFRLQAMEQ QAQLRDALND  360
ALTGEVQRLK IATAEIGVGD SCSSNAMAQQ NHMFQLQQHQ GQATPRPFYQ LQQQQQHNGN  420
HEPRE*
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast02G024600.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7281661e-104KJ728166.1 Zea mays clone pUT6436 bZIP transcription factor (bZIP64) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003562153.30.0transcription factor RF2b
TrEMBLI1HA860.0I1HA86_BRADI; Uncharacterized protein
STRINGBRADI1G76690.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35363576
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.39e-50bZIP family protein