PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast01G370700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family LBD
Protein Properties Length: 271aa    MW: 27207.8 Da    PI: 7.7176
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast01G370700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260140.84.4e-44321311100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaCk+lrrkC ++Cv+apyfp e+p+kfanvhk+FGasnv+kll++l +++reda+ssl+yeAear++dPvyG+vg i+ lq+q+++l+
  Brast01G370700.1.p  32 PCAACKFLRRKCLPGCVFAPYFPPEEPQKFANVHKVFGASNVTKLLNELLPHQREDAVSSLAYEAEARVKDPVYGCVGAISVLQRQVHRLQ 122
                         7****************************************************************************************** PP

              DUF260  92 aelallkee 100
                         ++l+++++e
  Brast01G370700.1.p 123 KDLDAAHSE 131
                         ****99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.3931132IPR004883Lateral organ boundaries, LOB
PfamPF031952.7E-4332129IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MASPSSTGNS GVSVVASASA SASASTPGAG SPCAACKFLR RKCLPGCVFA PYFPPEEPQK  60
FANVHKVFGA SNVTKLLNEL LPHQREDAVS SLAYEAEARV KDPVYGCVGA ISVLQRQVHR  120
LQKDLDAAHS ELLRYACADV VIPTALPVVN ASAAGRAMPC PAQLSAGIYG GGRRLGLGVG  180
VGGLVDAIAP PMPPSSSAGC YYMRSSNNNA PGGGGGVVSG ADVAPVQIPY ASMANWAVNS  240
IISTSTATAA AGSGSESIGM DHKEGGDSSM *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-82221511131LOB family transfactor Ramosa2.1
5ly0_B2e-82221511131LOB family transfactor Ramosa2.1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00581DAPTransfer from AT5G63090Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast01G370700.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHE6508360.0HE650836.1 Brachypodium sylvaticum genomic construct, BACs 73P1 and 17E7.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010230496.11e-139LOB domain-containing protein 6
RefseqXP_014753892.11e-139LOB domain-containing protein 6
TrEMBLI1HCD91e-138I1HCD9_BRADI; Uncharacterized protein
STRINGBRADI2G04270.11e-139(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP88133545
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.42e-62LBD family protein