PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast01G367200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family bZIP
Protein Properties Length: 192aa    MW: 20326.3 Da    PI: 10.6772
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast01G367200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_137.84.2e-12100158260
                         XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklk 60 
                         ke  r +r+ +NR++A+  R+RKka++ eLe k+k Le  N +L +++++l++e  +l+
  Brast01G367200.1.p 100 KEQNRLKRLLRNRVSAQQARERKKAYMTELEVKAKDLELRNAELEQKVSTLQNENNTLR 158
                         78899*************************************************99886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.4E-1299163IPR004827Basic-leucine zipper domain
PfamPF001704.7E-11100161IPR004827Basic-leucine zipper domain
PROSITE profilePS5021712.059101164IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.5E-16104163No hitNo description
SuperFamilySSF579596.13E-12104161No hitNo description
CDDcd147043.56E-16104154No hitNo description
PROSITE patternPS000360106121IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 192 aa     Download sequence    Send to blast
MAAQEQEQEK QQAKTSTTSS LPSSSERSSS SGPNNLKEGG AESDEEIRRV PEMGGGSASS  60
GAGGGDDGKQ LQQQQQKHGA GGHPPASAAG KKRGRAAGDK EQNRLKRLLR NRVSAQQARE  120
RKKAYMTELE VKAKDLELRN AELEQKVSTL QNENNTLRQI LKNTTAHAGK KSSGGGKGGE  180
GGKKQHHFGK S*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18995GKKRGRA
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that promotes photomorphogenesis in the light and positively regulates fruit pigmentation and fruit nutritional quality. Probably acts downstream of the light receptor network and directly affects transcription of light-induced genes. {ECO:0000269|PubMed:15178762}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast01G367200.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0350881e-145BT035088.1 Zea mays full-length cDNA clone ZM_BFb0038J16 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003569436.14e-75transcription factor HY5
SwissprotQ9SM502e-43HY5_SOLLC; Transcription factor HY5
TrEMBLI1HCH79e-74I1HCH7_BRADI; Uncharacterized protein
STRINGBRADI2G04590.12e-74(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP140838111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11260.19e-29bZIP family protein
Publications ? help Back to Top
  1. Wang F, et al.
    Light Signaling-Dependent Regulation of Photoinhibition and Photoprotection in Tomato.
    Plant Physiol., 2018. 176(2): p. 1311-1326
    [PMID:29146776]
  2. Liu CC, et al.
    The bZip transcription factor HY5 mediates CRY1a-induced anthocyanin biosynthesis in tomato.
    Plant Cell Environ., 2018. 41(8): p. 1762-1775
    [PMID:29566255]