PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast01G364600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family G2-like
Protein Properties Length: 484aa    MW: 50626.2 Da    PI: 6.1172
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast01G364600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.31.2e-31272327156
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                         k+r++W+peLH+rFv+a++ LGG+++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Brast01G364600.1.p 272 KARRCWSPELHRRFVNALQILGGAQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 327
                         68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.652269329IPR017930Myb domain
SuperFamilySSF466895.85E-17270330IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.0E-28270330IPR009057Homeodomain-like
TIGRFAMsTIGR015572.8E-26272327IPR006447Myb domain, plants
PfamPF002491.0E-6274325IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009266Biological Processresponse to temperature stimulus
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0010452Biological Processhistone H3-K36 methylation
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:1903507Biological Processnegative regulation of nucleic acid-templated transcription
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 484 aa     Download sequence    Send to blast
MDSSPSDLTL DYTPNGNGGH PMTPKQAPPL VHQEQQHNLT AAEQASGATI QKLQEFLSRL  60
DDERLKIDAF KRELPLCMQL LNQAMEAYRQ QLEACQTGSG CHGGAAGPGP GRAPLVLEEF  120
IPLSKNIGAA AEVQNQKAGA ENPKASWMVS AQLWNGSSAD APQTPKERSE HPPALDAGGG  180
GNAAGAFLPF TKEMIGSHGP AAAALLPELA LAPGAEKDAM ATGDKKPYLL PHDAGGGGNL  240
GASRRDDGGS PATTAAAAAE AGQAAPPQTN RKARRCWSPE LHRRFVNALQ ILGGAQVATP  300
KQIRELMKVD GLTNDEVKSH LQKYRLHTRR PMQAPTAPPA GAPQLVVLGG IWMPPDYAAQ  360
AAGPAAIYGA HPATQAHYTA AVSSAAAQEY YHSAAAQHHH MQHHHHTAAA MAHGRAVAPQ  420
PPPPAAYKVH RPAAASPESE GRGSGGGRER SESIEEEGEG EDEEDDEDGL VANADADADE  480
IKY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A3e-13272325255Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B3e-13272325255Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-13272325154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-13272325154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-13272325154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-13272325154Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A3e-13272325255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C3e-13272325255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D3e-13272325255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F3e-13272325255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H3e-13272325255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J3e-13272325255Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may play a role in regulatory networks controlling development and metabolism. {ECO:0000250|UniProtKB:Q6Z869}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00261DAPTransfer from AT2G03500Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast01G364600.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0865721e-122BT086572.2 Zea mays full-length cDNA clone ZM_BFc0184N23 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003565416.21e-176transcription factor NIGTH1
SwissprotQ5VRW21e-123NOH1_ORYSJ; Transcription factor NIGTH1
TrEMBLI1HCK21e-174I1HCK2_BRADI; Uncharacterized protein
STRINGBRADI2G04810.11e-175(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP97733338
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.14e-39G2-like family protein
Publications ? help Back to Top
  1. Kamrul Huda KM, et al.
    Salinity and drought tolerant OsACA6 enhances cold tolerance in transgenic tobacco by interacting with stress-inducible proteins.
    Plant Physiol. Biochem., 2014. 82: p. 229-38
    [PMID:24992889]