PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast01G293000.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family bZIP
Protein Properties Length: 330aa    MW: 36793.3 Da    PI: 7.733
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast01G293000.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.42e-104585545
                        CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaL 45
                        k  rr+++NReAAr+sR+RKka++++Le+   +L++  ++L
  Brast01G293000.2.p 45 KTMRRLAQNREAARKSRLRKKAYVQQLENSRLKLTQLEQEL 85
                        7789************************9877777766555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.6E-841104IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.4964387IPR004827Basic-leucine zipper domain
PfamPF001702.0E-74585IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.87E-74588No hitNo description
Gene3DG3DSA:1.20.5.1708.3E-84690No hitNo description
PROSITE patternPS0003604863IPR004827Basic-leucine zipper domain
PfamPF141442.7E-34127202IPR025422Transcription factor TGA like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MAEASPRTDT STDDTDENHM LEPGQVALVV SDSSDRSREK NGDQKTMRRL AQNREAARKS  60
RLRKKAYVQQ LENSRLKLTQ LEQELQRARQ QGIFISSSAD QSHSTSGNGA IAFDVEYSRW  120
LEEHNRQVNE LRAAVNAHAS DNDLHSVVEK IMSHYEEIYK QKGNAAKADV FHVLSGMWKT  180
PAERCFLWLG GFRPSEVLKL LSTQLEPLTE LQLSGICNLQ HSSQQAEDAL SQGMEALQQS  240
LAETLAGSIG TSGSTGNVAN YMGQMAMAMG KLGTLENFLR QADNLRQQTL QQMQRILTTR  300
QSARALLVIS DYSSRLRALS SLWLARPKE*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-TGACG-3'. Recognizes ocs elements like the as-1 motif of the cauliflower mosaic virus 35S promoter. Binding to the as-1-like cis elements mediate auxin- and salicylic acid-inducible transcription. Binds to the hexamer motif 5'-ACGTCA-3' of histone gene promoters.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast01G293000.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2514600.0AK251460.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf125e16, mRNA sequence.
GenBankAK3572390.0AK357239.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1048N17.
GenBankAK3593910.0AK359391.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1095N07.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010230791.10.0transcription factor HBP-1b(c38)
SwissprotP239230.0HBP1B_WHEAT; Transcription factor HBP-1b(c38)
TrEMBLI1HEK90.0I1HEK9_BRADI; Uncharacterized protein
STRINGBRADI2G10830.10.0(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12250.21e-147TGACG motif-binding factor 6
Publications ? help Back to Top
  1. Tabata T,Nakayama T,Mikami K,Iwabuchi M
    HBP-1a and HBP-1b: leucine zipper-type transcription factors of wheat.
    EMBO J., 1991. 10(6): p. 1459-67
    [PMID:2026143]