PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast01G288900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family M-type_MADS
Protein Properties Length: 250aa    MW: 27288.5 Da    PI: 9.4637
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast01G288900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF57.51.7e-181150342
                        --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
              SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                        i n+  r  tf kRr+g++KKA+EL +LCd++++v+++++
  Brast01G288900.1.p 11 IPNDATRRATFKKRRKGLMKKASELATLCDVKACVVVYGE 50
                        779999********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004329.5E-23160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006618.502150IPR002100Transcription factor, MADS-box
CDDcd002665.78E-33285No hitNo description
SuperFamilySSF554556.15E-25395IPR002100Transcription factor, MADS-box
PRINTSPR004048.1E-11323IPR002100Transcription factor, MADS-box
PfamPF003196.4E-181150IPR002100Transcription factor, MADS-box
PRINTSPR004048.1E-112338IPR002100Transcription factor, MADS-box
PRINTSPR004048.1E-113859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0043078Cellular Componentpolar nucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MARKKVTLQW IPNDATRRAT FKKRRKGLMK KASELATLCD VKACVVVYGE GEAQPEVWPS  60
VAEAVPILNR FKEMPELDQC KKMMNQEDFL RQRIDKLREQ IHKAGRENRE RDTTSLVHKA  120
MVGCLPGLTG LTIEELTSVG WMVEMRLKGL SDRIASVRGQ KASFSAPYGN MMMADTGAPS  180
QMYIQAPQKE AGWLDMVRSG GDLGALVYSG FTGGSAAGDG MAQFSNMGAG FSWAWGADPG  240
PSGSSFLPM*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224RKKVTLQWIPNDATRRATFKKRR
22125KKRRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00553DAPTransfer from AT5G48670Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast01G288900.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003565683.11e-162agamous-like MADS-box protein AGL80
TrEMBLA0A0Q3IDM41e-160A0A0Q3IDM4_BRADI; Uncharacterized protein
STRINGEMT028026e-93(Aegilops tauschii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36336202
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.18e-32AGAMOUS-like 80