PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast01G288700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family M-type_MADS
Protein Properties Length: 338aa    MW: 37597.2 Da    PI: 9.6975
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast01G288700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF47.42.5e-151050242
                        ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
              SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                        ri n+  r+ tf +R+n + KKA+EL +LC+++++vi++++
  Brast01G288700.1.p 10 RIPNDAARHATFRNRQNVLVKKASELATLCNVKACVIVYAE 50
                        899************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.1E-18160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006617.114150IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.5E-21294IPR002100Transcription factor, MADS-box
CDDcd002668.83E-23282No hitNo description
PRINTSPR004041.8E-7323IPR002100Transcription factor, MADS-box
PfamPF003192.1E-141050IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-72338IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-73859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MGRKKVTLQR IPNDAARHAT FRNRQNVLVK KASELATLCN VKACVIVYAE GEAQPEVWSS  60
VDEVVPILHR YKAMPEIGQC KKTVTQEDFL RQRMDKLKKK VNKAVHENRE LDTACLVHKA  120
MLGHLPRLEG LTVEEVANVG WMVQMKLKSL GDRIANLQAQ AGLQLHAQPA PPVTYVQQAP  180
QQETWLNMVR PPQVHSGFTG GNDASSSMAH NNMASTNANG GFSWQWHAGN STSSFHPIRR  240
NLGEKEEEDK ANLPVPLICL GVVGVEQMVF ESVVVGGGLR IFDGDELRCT REETKRVTRL  300
HCWRAIDRAL TGKLVGEFAG VEFQRGWDKR RLGGKVV*
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast01G288700.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010230798.31e-120agamous-like MADS-box protein AGL80
TrEMBLA0A0Q3FX611e-110A0A0Q3FX61_BRADI; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36336202
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.15e-27AGAMOUS-like 80