PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast01G287500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family SBP
Protein Properties Length: 915aa    MW: 101402 Da    PI: 7.5962
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast01G287500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1215.6e-38146220276
                         -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
                 SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 
                         Cqv+gC+adl + ++yh+rhkvCevh+k++vv ++++e+rfCqqCsrfh l efDe+k+sCr+rLakhn rrrk 
  Brast01G287500.1.p 146 CQVDGCHADLRDSRDYHKRHKVCEVHTKSTVVRIKNIEHRFCQQCSRFHLLPEFDEGKKSCRSRLAKHNGRRRKV 220
                         *************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.5E-30143207IPR004333Transcription factor, SBP-box
PROSITE profilePS5114130.812143220IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.09E-35144223IPR004333Transcription factor, SBP-box
PfamPF031101.2E-28146219IPR004333Transcription factor, SBP-box
SuperFamilySSF484032.49E-6643792IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.205.9E-5644790IPR020683Ankyrin repeat-containing domain
CDDcd002043.05E-5688789No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 915 aa     Download sequence    Send to blast
MSLPTTVGSR TAEREGLMEA GFRREGGQTG LATTMSSELN NNKKKKGLEW DLNDWRWDGN  60
LFLATPSSAA PSGCGSRELG RSEDGIDFSV ADKRRRVSPV DNHGECSNAA IANGDHDRVV  120
GRRGQSSREG RHANATGAYS TCAPYCQVDG CHADLRDSRD YHKRHKVCEV HTKSTVVRIK  180
NIEHRFCQQC SRFHLLPEFD EGKKSCRSRL AKHNGRRRKV PAQAGVAGNT SSENQSLTNT  240
LLLLLKQLSG QDPIVMNSGY PHYFVVAAGS SSDQSNGPNF LVNLLKNLSA IAGTQAYQDM  300
LKNANSASIS SNDGNYVVNG FINEPTRPPI PVGTESSAVK QHVQNFDLND AYVEEDESRT  360
DKIVFKLFGK EPKDFPVDLR AQMLNWLSHY PSDMESHIRP GCVILTIYLR LPNWIWDKLK  420
VDPAPWIENL ISISTDGFWK TGWLYTRLQD RLALSCNGRL MLVSPWQPII GDKHQILCVT  480
PIATACSSTA NFSVKGFNIV QPTTKLLCVF GGEYLIQEAT QMLHEDTMMQ QGPQCLTFSC  540
SFPSMSGRGF IEVEDYDQSS LSFPIVVAEE SVCSEIRMLE DKLNLIAFGD ILEGREDLMA  600
SRDQALNFLQ EIGWFLQRSH KRATTDAPQY CTESFPVARF RWLLSFAIDQ EWCSVVRKLL  660
DTLFQGNIDL DVRSPFEFVL GEGLVFTAVN KRSKRLVEFL LRYTTNSALV ARGAVSPVRF  720
LFTPDITGSS NITPLHIAAS ISDGGGVLDA LTDDPQQLGI KAWKNARDTT GYTPEDYAQK  780
RGHISYIEMV ENKINSRLPK AHVSISMTII SPSATDIAEK HAGPSMSTNQ TTLDVEKNQR  840
SDKRPPSCRS CVQLQHISYH PRPNRFLSNR PAVLSLVAIG AVCVCVGLIM QSPPTVGVGM  900
TGPFLWSSLN YGPI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-281462191184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
19296KRRRV
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast01G287500.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010230803.10.0squamosa promoter-binding-like protein 1 isoform X2
SwissprotQ9LGU70.0SPL1_ORYSJ; Squamosa promoter-binding-like protein 1
TrEMBLA0A2K2D7Y70.0A0A2K2D7Y7_BRADI; Uncharacterized protein
STRINGMLOC_34539.40.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19983892
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.11e-180squamosa promoter binding protein-like 1
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Zhang H,Zhai J,Mo J,Li D,Song F
    Overexpression of rice sphingosine-1-phoshpate lyase gene OsSPL1 in transgenic tobacco reduces salt and oxidative stress tolerance.
    J Integr Plant Biol, 2012. 54(9): p. 652-62
    [PMID:22889013]
  3. Zhang H, et al.
    Molecular characterization of rice sphingosine-1-phosphate lyase gene OsSPL1 and functional analysis of its role in disease resistance response.
    Plant Cell Rep., 2014. 33(10): p. 1745-56
    [PMID:25113543]