PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast01G271500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family M-type_MADS
Protein Properties Length: 391aa    MW: 41619.2 Da    PI: 5.0532
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast01G271500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF36.75.6e-121052244
                        ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
              SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                        +i n++ r  t++ R +g+ KKAeEL +LC + va++ ++  g
  Brast01G271500.1.p 10 FIGNTRARAATYASRTKGLRKKAEELATLCSVPVALVCAAAAG 52
                        799**********************************988766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554559.03E-16174IPR002100Transcription factor, MADS-box
SMARTSM004328.7E-11160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006615.432152IPR002100Transcription factor, MADS-box
PfamPF003195.0E-111052IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 391 aa     Download sequence    Send to blast
MPRRKIAMRF IGNTRARAAT YASRTKGLRK KAEELATLCS VPVALVCAAA AGAPPLVWES  60
REGVLDRYRA LPAEVRAQHT HRGYLEADLG KGRAKHARVR QHGLGALADQ DAALLSGMAL  120
HEARELLEAV EAALLATTRR MEALGLPATT NDVDGDLQEL EQFEFPDCLD AAMMLPGVGS  180
SSNPFVDMDA GFHQLQMMPA GHGNYGFPAG QGQMEQQFSW DDRMQRNAEM TVQPAYGFQC  240
TDANYSGAGA VGGGYGQQMQ QPVYGNADHY GWTDLTMWNT DDFSCNAALP PAGCYNSLGS  300
GNGGGGGTAA VPQHSALVAT GGGDYIDAQP LGYAMGNGMG ANFASQQDGY ATHWSAEEFQ  360
RADNTGTSQL AATSTTWTRT SSDQVFNYLQ *
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast01G271500.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003565738.10.0uncharacterized protein LOC100843549
TrEMBLA0A0Q3FXQ20.0A0A0Q3FXQ2_BRADI; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP45722960