PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast01G239100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family LBD
Protein Properties Length: 297aa    MW: 32220.2 Da    PI: 7.1645
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast01G239100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601223.2e-38211211101
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         aC+aCk++rr+Ca++C lapyfpae+p +f+n h+lFG +n+lk+l+++p+e+r+d m+s++yeA+ ra++P  Ga+g +l+lqq++ +l+
  Brast01G239100.1.p  21 ACSACKHQRRRCAPGCLLAPYFPAENPGSFRNSHRLFGIKNILKFLTRAPPEKRDDCMRSMLYEADQRASNPALGAHGAVLSLQQEYVRLS 111
                         7****************************************************************************************** PP

              DUF260  92 aelallkeel 101
                         a+la+l+++l
  Brast01G239100.1.p 112 AQLAALQKQL 121
                         *****99985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.21620121IPR004883Lateral organ boundaries, LOB
PfamPF031951.7E-3521118IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
SSSSSSYTPP AAQQEQQQHL ACSACKHQRR RCAPGCLLAP YFPAENPGSF RNSHRLFGIK  60
NILKFLTRAP PEKRDDCMRS MLYEADQRAS NPALGAHGAV LSLQQEYVRL SAQLAALQKQ  120
LARYRNEAEH QQQQYRADAA AIDVVVPPAG FLPTPPLQQQ QQHRAASALD AIVRPAGFFP  180
PPMQQPWMMP PAPTLPLTIP EEEPQPPIYG SFLVEVPPAG GEKIDDDEDE DAKIGVKSDE  240
DGVSSSMQQR HDNAAGEVQA FVGGVASSSS SGYRSSNLAP RGLNRRMLGV KFNPAA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-272212412114LOB family transfactor Ramosa2.1
5ly0_B1e-272212412114LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast01G239100.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0Q3GCV71e-115A0A0Q3GCV7_BRADI; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP158291113
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.12e-25LOB domain-containing protein 22