PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast01G220100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family M-type_MADS
Protein Properties Length: 201aa    MW: 21462.2 Da    PI: 8.5163
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast01G220100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF63.52.2e-201964247
                        ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEE CS
              SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgkly 47
                        +i n s rqvtfskRr g++KK +EL +LC+a+v +++fs+ g+++
  Brast01G220100.1.p 19 PIANRSSRQVTFSKRRSGLFKKGSELAILCGARVVLVVFSEVGNVF 64
                        799**************************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006624.5021070IPR002100Transcription factor, MADS-box
SMARTSM004321.0E-251069IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.19E-221176IPR002100Transcription factor, MADS-box
PRINTSPR004044.3E-181232IPR002100Transcription factor, MADS-box
PfamPF003194.8E-212064IPR002100Transcription factor, MADS-box
PRINTSPR004044.3E-183247IPR002100Transcription factor, MADS-box
PRINTSPR004044.3E-184768IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 201 aa     Download sequence    Send to blast
MVRPRGKPST GRHRIEMSPI ANRSSRQVTF SKRRSGLFKK GSELAILCGA RVVLVVFSEV  60
GNVFALGSPS ADAVLGAAPD GGGGEREREA LEEICRAREE AAERVAAETA RMDSIGDRVV  120
QAQAGRRFWW EADVEMLGEA ELPEFARALK RFRDDVRRHA DKLLSAPHDA APVAAPAPCT  180
AAAVSPGAHG DPSSSNSWAY *
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast01G220100.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4693430.0KF469343.1 Brachypodium distachyon MADS-box transcription factor 49 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001288327.12e-97agamous-like MADS-box protein AGL62-like
TrEMBLI1HPB84e-96I1HPB8_BRADI; MADS-box transcription factor 49
STRINGBRADI2G43290.17e-97(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28333088
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.15e-21AGAMOUS-like 62