PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast01G189800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family WOX
Protein Properties Length: 500aa    MW: 51682.2 Da    PI: 8.1695
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast01G189800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox50.82.9e-1662122257
                         T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
            Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                         ++R+++ +eq+++Le+lF++   +p ++e+ ++ +kl     + +++V++WFqNr+ + k+
  Brast01G189800.1.p  62 KPRWNPRPEQIRILEALFNSgMANPPRDEIPRIRMKLqeygPVGDANVFYWFQNRKSRSKN 122
                         89*****************99****************99999****************995 PP

2Wus_type_Homeobox107.21e-3461124265
   Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                         +++RW+P+peQi+iLe+l++sG+ +P+++ei ri+++L+eyG ++d+NVfyWFQNrk+R+++kq
  Brast01G189800.1.p  61 PKPRWNPRPEQIRILEALFNSGMANPPRDEIPRIRMKLQEYGPVGDANVFYWFQNRKSRSKNKQ 124
                         579***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.11E-1154123IPR009057Homeodomain-like
PROSITE profilePS5007110.23658123IPR001356Homeobox domain
SMARTSM003894.7E-760127IPR001356Homeobox domain
CDDcd000862.77E-661124No hitNo description
Gene3DG3DSA:1.10.10.601.9E-661128IPR009057Homeodomain-like
PfamPF000467.2E-1462121IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009735Biological Processresponse to cytokinin
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0010075Biological Processregulation of meristem growth
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 500 aa     Download sequence    Send to blast
MASPNRQTWP SMFRSKHASQ LWQSQPDMSS SPPSLGSGST AAGRTFKSPF YSGPEERNTD  60
PKPRWNPRPE QIRILEALFN SGMANPPRDE IPRIRMKLQE YGPVGDANVF YWFQNRKSRS  120
KNKQLRAGSA SRAAPAARAC ARPHAAAPCM TPPPPKQQAP LVSPMMAPTS SSSSSSDRSS  180
GSSKPVKPTA AAMDLLSPLA AACHQQMHYQ QLGLGQPATV SAPAAAAALE EFAPTDVEPI  240
FLQYPQGHCL SAGELAAILG AQCMHVPVQQ QQQPASPAGM LLGLCNELAA GPTSAGHRSS  300
AWTGAGLGQY WPSGAHQLGL GKGSEPFNTS AAATEVAHED ATKLGLLHYG FGLSSPAVNA  360
ATSAPTAVLA SSPETGAVTV ASAAAAAGLS NLFATTNAAT SEAVTYSHLQ EAEAADVGFA  420
GSAATGVVPR GAAVVVCIAG TNAVCNVPAG HLHVKAYFGD GALLARWSGG RFEPLAVDMS  480
SGLTVEPLQH GAIYYCVLI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126092e-82CP012609.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 1 sequence.
GenBankAP0149572e-82AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankAP0037602e-82AP003760.4 Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:OSJNBb0063G05.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003566976.10.0PREDICTED: WUSCHEL-related homeobox 7
SwissprotQ0JKK61e-119WOX7_ORYSJ; WUSCHEL-related homeobox 7
TrEMBLA0A0Q3J9R40.0A0A0Q3J9R4_BRADI; Uncharacterized protein
STRINGLOC_Os01g47710.11e-117(Oryza sativa Japonica Group)
STRINGBGIOSGA001059-PA1e-117(Oryza sativa Indica Group)
STRINGORGLA01G0211300.11e-117(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26663470
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33880.14e-40homeobox-3