PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast01G187900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family HB-other
Protein Properties Length: 1849aa    MW: 205896 Da    PI: 5.0137
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast01G187900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox551.4e-1751105357
                         --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
            Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                         kR   t++ql++Le+ +  ++yps+++r+eL+ k+gL++rq ++WF+ rR k++k
  Brast01G187900.1.p  51 KRMMKTPYQLDVLEQTYLAEQYPSEAMRAELSVKIGLSDRQLQMWFCHRRLKDRK 105
                         79999************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.1E-1632105IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-1636105IPR009057Homeodomain-like
PROSITE profilePS5007115.56446106IPR001356Homeobox domain
SMARTSM003891.9E-1648110IPR001356Homeobox domain
PfamPF000463.1E-1551105IPR001356Homeobox domain
CDDcd000861.29E-1351106No hitNo description
SMARTSM005711.2E-15624683IPR018501DDT domain
PROSITE profilePS5082715.573624683IPR018501DDT domain
PfamPF027911.1E-15627680IPR018501DDT domain
PfamPF050669.0E-15799867IPR007759HB1/Asxl, restriction endonuclease HTH domain
PfamPF156126.6E-1010221064IPR028942WHIM1 domain
PfamPF156139.5E-1312011273IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1849 aa     Download sequence    Send to blast
MDAGGGDGDG PPLEAPEERT SPPPAPATVA APASGSGGGA GPSGSGDKPV KRMMKTPYQL  60
DVLEQTYLAE QYPSEAMRAE LSVKIGLSDR QLQMWFCHRR LKDRKPPAKR QRRDEEAPAA  120
PVLVPPPVLP LQAMPLASSD LMMSAVSPYD EPLPPTHPRR GGGRSSAVPR ISAPDIGRRY  180
YEPLPVMMSP PVPPMQFRQA ELRVINSVES QLGEPLREDG PVLGVEFDPL PPGAFGAPIV  240
PEQQKQPVRS YDANIFSRHD PNLLKVSSFL PSMEHPFVPN SFAGKRKSTI GNTSQDQPHG  300
GSRAVHEYQF LPEQPSDTYE RASRSHYYDT PVEASNSRIS SLTPGSHLLH GSEEVAPGYA  360
FEGQISGSGL LPQSGRPQVF PAASTDYEMN QSNNNLNSVP VEGQFGISQV AGYEDPLISS  420
EGRAHLDEDA SRLDRKRKHN EEAKIAKEVE AHERRIRKEL EKQDMLRKKR EEQMRKEMER  480
HDRERRKEEE RLLRERQREE ERFQREQKRE HERMEKFLQK QSRRAEKQRQ KEELRKEKEA  540
ARQKAANERA TARRIAREYM ELVEDERLEL MELAAQSKGL PSMLSLDSDT LQQLDSFRGM  600
LSQFPPETVK LKVPLLIKPW TGSENNLGNL LMVWKFLITF ADVLGLSAVT LDEFVQSLHD  660
YDSRLLGEFH VALLKSIIKD IEDVARTPSV ALGVNPGGGH PQIVEGAYSW GFNIRSWQHH  720
LNLLTWPEIL RQFALSAGFG PQLKKRNAED VFYRDENEGQ DGQNVISTLR NGSAAVRAAA  780
LMKERGYTHR RSRHRLTPGT VKFAAFHVLS LEESNGLTIL EVAEKIQKSG LRDLTTSKTP  840
EASIAAALSR DTKLFERTAP STYCVKSPYR KDPADSEAIL SAAREKIRAF QNVLSDSEVE  900
KEVDDAERDE DSECDDADDD PDVDDVNIEV GDGDPLAVKA QDVVPMATEV GDIKGEADSM  960
DTALTQPSSF AKSEKGATIL SLDKSNTAGT SSSVSPLRAS SDHHEVITGT AEDAEIDESY  1020
QGESWVQGLA EGDYYNLSVE ERLNALVALV GVATEGNSIR AVLEERLEAA NAIKKQMWAE  1080
AQLDKRRSKE EFASRMQYSS YTSLKADVNP EHNATETTPT PARNIDIDND GNMGAVNNTE  1140
ILDQYSHSNA GNVSYERNGA GQDISATPDN LSAQQYAYAD KTRSQLKSYI GHRAEQLYVY  1200
RSLPLGQDRR RNRYWQFSTS ASPNDPGSGR IFFESRDGDW RVIDSEEAFD SLVASLDTRG  1260
SREAQLHLML QRIEATFKEG IKRKSNAATE QPAGRYLKNG ATDLMQGSYR SEFGSPSSTL  1320
STVSSDSFRI ELGRNDAEKT AISKRADGFL KWMWRECYDR NLTCAVKYGK KRCSALIHSC  1380
SYCYQIYLAE ERHCSSCHKI FKSIHNFSEH VSQCEEKRRT DPNWKMQIED YSVPIGIRLL  1440
KLQLATIEAM IPSEALQPFW TDGYRKSWGV KLHSTESVEE IFQMLTLLEG GIRRDYLSSD  1500
FERTSEYLNL NIQDMHSQNS FGLSGASVLT WVPDTIAAIT LRMLELDYAV SYTQNQKTER  1560
DGGDSMKLPS RHTVVKKTQH IEPLEPASVD LYDGRWAPSS GRRGRGRGSR GGSRGGRGRS  1620
RGGRVPRGIS SASRIEFRDD SAAYEKAPRK NARRGRGRGR GRGRGRRTVR PRQPSSDGRG  1680
RSIPKANLLG SFSMLSNVKP ATVAESPRSS GAEEWGLEDR RPYMEVDENS SGSQSDQSED  1740
IEENGQPMDE DYDEQVPDYS IAYSSGSRPH GVMDDETDEE DEDAERDAEG DEDGEDDDVN  1800
HAAAADADDD EMDEDDDIGD DGDDGGDGVE ANADADEGAT SYSSEYSE*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
116551664RGRGRGRGRG
216551665RGRGRGRGRGR
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast01G187900.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003566982.10.0homeobox-DDT domain protein RLT2
TrEMBLA0A0Q3MXW20.0A0A0Q3MXW2_BRADI; Uncharacterized protein
STRINGBRADI2G46230.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22833352
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44180.10.0Homeodomain-like transcriptional regulator