PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast01G142000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family bZIP
Protein Properties Length: 294aa    MW: 32169.6 Da    PI: 6.8022
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast01G142000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1346.6e-11168213449
                         XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkel 49 
                          kr +r   NR +A+rsR RK+++i eLe+ v +L++e + L  ++
  Brast01G142000.1.p 168 PKRVKRILANRQSAQRSRVRKLQYISELERCVTTLQNEVSVLSPRV 213
                         5999*********************************988776655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.1E-14165229IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.53167219IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.7E-13169222No hitNo description
PfamPF001703.0E-9169213IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.79E-11169223No hitNo description
CDDcd147033.35E-25170221No hitNo description
PROSITE patternPS000360172187IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MRTHRHSAFG TGIGMAQLPP KIPMPAHHHW PGGAVDAPHH HQQHSVAWAD EFAEFAAARR  60
GAHRRSLSDS VAFVEVMAPG GAGDFDRLDD DQLMSMFPDE GHGGGSATAA PGSENGTSSD  120
SDGVKQNGKD RRDQCDDDGQ NNDEANPEEE PAPGRATPTS STETIRDPKR VKRILANRQS  180
AQRSRVRKLQ YISELERCVT TLQNEVSVLS PRVAFLDQQR TILTVGNSHL KQRIAALAQD  240
KIFKDAHQEA LKEEIERLRQ VYQQQNLRMS SAPASDHAHG GPPPVRAEKE LIS*
Functional Description ? help Back to Top
Source Description
UniProtTranscription regulator. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast01G142000.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003569840.11e-170basic leucine zipper 6
SwissprotQ5JMK61e-114BZP06_ORYSJ; Basic leucine zipper 6
TrEMBLI1HRQ01e-168I1HRQ0_BRADI; Uncharacterized protein
STRINGBRADI2G50220.11e-169(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132238125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58120.13e-66bZIP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]