PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast01G120100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GRAS
Protein Properties Length: 757aa    MW: 83495.3 Da    PI: 4.8513
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast01G120100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS357.52e-1093797502373
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                          + L++cA+av++gd + a++lL+++++++  +gd+mqRla++f+e+L+arla+++s++y++l +++ts   ++e l+a+klf  ++ + k
  Brast01G120100.1.p 379 HTMLIHCAQAVATGDRRSATELLKQIKQHSGLRGDAMQRLAHCFAEGLEARLAGTGSQVYQSLVAKRTS---VVEFLKAYKLFMAACCFKK 466
                         578***************************************************************999...******************* PP

                GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvl 181
                         +s+  aN +Il+ v+g++r+Hi+Df++++GlQWp L++ La+R++gpp++RiTg++ p++g   + ++eetg+rL++ A+e+gvpf+fn  
  Brast01G120100.1.p 467 VSFGFANLTILNTVAGKSRLHIVDFGVQYGLQWPGLMRLLAEREGGPPEVRITGIDLPQPGfrPACQIEETGRRLSNCAREFGVPFKFNS- 556
                         ************************************************************99999*************************. PP

                GRAS 182 vakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfds 270
                         +a ++e+++ e+L ++p+E+l+V ++  l +l+des+ ++   +rd vL+ +++++P+v++ +  +  ++++ F++rf eal++ysa fd+
  Brast01G120100.1.p 557 IAAKWETVRAEDLGIDPNEVLVVLCQCGLSNLMDESLVTDGlsPRDLVLRNIRNMRPDVFIQCVANGTYGAPFFVTRFREALYFYSAHFDM 647
                         799*********************************99998789*********************************************** PP

                GRAS 271 leaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlg 361
                         l+a++pr+++er  +Er ++gr++ nv+acega+r+ r et+++W+ r ++aG++++pl+ +++k ak  +++++ + + ++ ++++l+ g
  Brast01G120100.1.p 648 LDATIPRDNDERLLIERDIIGRAALNVIACEGADRVDRPETYKQWQVRNHRAGLRQLPLNPEIVKLAKEKVKNHYHKDFIIDVDHQWLLRG 738
                         ***************************************************************************888************* PP

                GRAS 362 WkdrpLvsvSaW 373
                         Wk+r L++vS W
  Brast01G120100.1.p 739 WKGRVLYAVSTW 750
                         ************ PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098561.975352731IPR005202Transcription factor GRAS
PfamPF035146.8E-107379750IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 757 aa     Download sequence    Send to blast
MDATPEGFLR DGGYLVDPEP LSPSLFLDLP PTPRADGPPP AVDLDLDFIS RMLMEEDIDD  60
KFFYQYPDQP ALLAAQRPYA QIISDTTSSG SPTGTTATSD DSGSVINSNT ATSSSDDTRN  120
YTWPYDPIEL SQLLRSPTYD GDMGFGGLVT DSPADEDTRS SFFPGDGAPT AEFQQTAALF  180
KGAADGGITF VGPNGCSPGT QNSATLNDPA VEEKVKPDMF YDGDGSSAFF SGQTGGDMDM  240
LNMAFLKGME EANKFLPTNN TLLEVISDKP ALRRFTVKKE GLVDGTLTSG NGRGRKYRHD  300
ADNLEAETGR NSKLMMPEHE ETGAREMFDE IMLEEYEMCM KGMQDLRVAM DSEAKKNNTK  360
GTGKAARAKK GAGEVVDLHT MLIHCAQAVA TGDRRSATEL LKQIKQHSGL RGDAMQRLAH  420
CFAEGLEARL AGTGSQVYQS LVAKRTSVVE FLKAYKLFMA ACCFKKVSFG FANLTILNTV  480
AGKSRLHIVD FGVQYGLQWP GLMRLLAERE GGPPEVRITG IDLPQPGFRP ACQIEETGRR  540
LSNCAREFGV PFKFNSIAAK WETVRAEDLG IDPNEVLVVL CQCGLSNLMD ESLVTDGLSP  600
RDLVLRNIRN MRPDVFIQCV ANGTYGAPFF VTRFREALYF YSAHFDMLDA TIPRDNDERL  660
LIERDIIGRA ALNVIACEGA DRVDRPETYK QWQVRNHRAG LRQLPLNPEI VKLAKEKVKN  720
HYHKDFIIDV DHQWLLRGWK GRVLYAVSTW MAEDDS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-423827508374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003564369.10.0PREDICTED: scarecrow-like protein 34
TrEMBLI1HSE90.0I1HSE9_BRADI; Uncharacterized protein
STRINGBRADI2G52227.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29065.11e-148GRAS family protein