PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast01G103000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family LBD
Protein Properties Length: 247aa    MW: 25900.1 Da    PI: 5.8373
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast01G103000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260129.61.3e-40531521100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaCk+lrr+Ca++C++apyf  ++p+kfa+vhk+FGasnv+k+l ++pe er da++slvyeA+ r+rdPvyG++g i+ lqqq++ l+
  Brast01G103000.1.p  53 PCAACKLLRRRCAHECPFAPYFSPHEPSKFAAVHKVFGASNVSKMLLEVPEAERGDAANSLVYEANLRLRDPVYGCMGAISVLQQQVSALE 143
                         7****************************************************************************************** PP

              DUF260  92 aelallkee 100
                         ael+++++e
  Brast01G103000.1.p 144 AELEAVRAE 152
                         ****99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.15252153IPR004883Lateral organ boundaries, LOB
PfamPF031959.6E-4153150IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MSTERERLDE IGKKIKREPD AAGGFVVASS ASPVEHHVSR RLVLGGAPNT ATPCAACKLL  60
RRRCAHECPF APYFSPHEPS KFAAVHKVFG ASNVSKMLLE VPEAERGDAA NSLVYEANLR  120
LRDPVYGCMG AISVLQQQVS ALEAELEAVR AEIFKHRYRQ ASQQLMAGGG DDAGFMQATA  180
MAMPPVHAAD DDVVSVAAAA AAGQDVLAGG IPGTPTVYAA TGQQPSSSAA DDYGSLNTSE  240
HDAYFG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-42481566114LOB family transfactor Ramosa2.1
5ly0_B3e-42481566114LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast01G103000.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY7955611e-142AY795561.1 Triticum aestivum LOB1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010233540.21e-158LOB domain-containing protein 15
SwissprotQ8L5T55e-68LBD15_ARATH; LOB domain-containing protein 15
TrEMBLI1HSY41e-157I1HSY4_BRADI; Uncharacterized protein
STRINGBRADI2G53690.11e-158(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26303891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.13e-65LOB domain-containing protein 15
Publications ? help Back to Top
  1. Ohashi-Ito K,Iwamoto K,Fukuda H
    LOB DOMAIN-CONTAINING PROTEIN 15 Positively Regulates Expression of VND7, a Master Regulator of Tracheary Elements.
    Plant Cell Physiol., 2018. 59(5): p. 989-996
    [PMID:29444288]