PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast01G093300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family WOX
Protein Properties Length: 329aa    MW: 35332.6 Da    PI: 10.6652
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast01G093300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox54.61.9e-1758117357
                         --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
            Homeobox   3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                          R+t+++eq e Le l+++   +p+ae+++ +A++l     ++ ++V++WFqN++a++++
  Brast01G093300.1.p  58 ARWTPSQEQRELLEGLYRQgLCTPTAEQIQGIATRLrqhgPVEGKNVFYWFQNHKARQRQ 117
                         7*****************99*****************9999*****************96 PP

2Wus_type_Homeobox98.94e-3257118364
   Wus_type_Homeobox   3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 
                         ++RWtP++eQ ++Le ly++Gl tP++e+iq i+++L+++G +e+kNVfyWFQN+kaR+rq+
  Brast01G093300.1.p  57 NARWTPSQEQRELLEGLYRQGLCTPTAEQIQGIATRLRQHGPVEGKNVFYWFQNHKARQRQR 118
                         78***********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003895.4E-455122IPR001356Homeobox domain
PfamPF000466.1E-1558117IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.2E-658117IPR009057Homeodomain-like
SuperFamilySSF466895.99E-1158122IPR009057Homeodomain-like
CDDcd000860.0030959119No hitNo description
PROSITE profilePS500719.39459118IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009942Biological Processlongitudinal axis specification
GO:0010654Biological Processapical cell fate commitment
GO:0048825Biological Processcotyledon development
GO:0080167Biological Processresponse to karrikin
GO:0090451Biological Processcotyledon boundary formation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MDIPQKHGGA DTRNRSSSSS NNNNNQAPAI RLSLSPPGRV PVSPPMSPSS EAAVLANARW  60
TPSQEQRELL EGLYRQGLCT PTAEQIQGIA TRLRQHGPVE GKNVFYWFQN HKARQRQREK  120
QRKFEYFATQ FHRPMPIPVL HGPPPLLGHA AFPGGLPSLP APTPAPAPAC NNRSEVNMYM  180
QPNFFPQTPQ AAANANAVQS QTQAPLLYPG IGNAPALSMY QQPAPNSAGG TQQLRGMRFP  240
AFPSASGAAN GGSGSGARET LQLFPLQPTC WQMREKKKKN CSSTGSRSPS PMTPSGSGSA  300
SASSSFSWEP ESPKVPFYDF FGLQSGGR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003567259.11e-119PREDICTED: WUSCHEL-related homeobox 5-like
SwissprotA2WWU75e-46WOX5_ORYSI; WUSCHEL-related homeobox 5
SwissprotQ8LR865e-46WOX5_ORYSJ; WUSCHEL-related homeobox 5
TrEMBLI1HT891e-119I1HT89_BRADI; Uncharacterized protein
STRINGBRADI2G54590.11e-118(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP75093548
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59340.12e-20WUSCHEL related homeobox 2