PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast01G082600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family bZIP
Protein Properties Length: 409aa    MW: 43111.7 Da    PI: 5.0364
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast01G082600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_143.76.2e-14326369548
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 
                         +r rr++kNRe+A rsR+RK+a++ eLe +   L++eN +Lk e
  Brast01G082600.1.p 326 RRHRRMIKNRESAARSRARKQAYTVELEAELGYLKEENARLKAE 369
                         689**************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.1E-12322387IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.576324369IPR004827Basic-leucine zipper domain
CDDcd147073.38E-24326367No hitNo description
PfamPF001701.0E-11326370IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.9E-13326369No hitNo description
SuperFamilySSF579597.5E-11326371No hitNo description
PROSITE patternPS000360329344IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009409Biological Processresponse to cold
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0010152Biological Processpollen maturation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 409 aa     Download sequence    Send to blast
MASEMSKNVM VSDDQEVTSQ QRDQLSGGAA AAEGHVEQQA VAPLERQPSS ILERTLEELS  60
YSLYEGRGLG SINMDEFVAN IWNTEEFQAA TGGGFIVDME NQTAVVGAAG RSGEGSGTLL  120
RQGSFSLPPP LSRKTVDEVW AEINDEGPLA QAQAPVLLPQ APPQPLAVQP PMGNGGGVAA  180
NGRQATLGSM TLEDFLVKAG VVRGGIAGQG QAAMPGGQLA HGPMNAMQQG QVQPVGPMMY  240
PMAPANAMYP MMGDGMGFPG NGYADMAILP PPLSQGGVGI LSPGSSDGIS AMTNCFGGGS  300
QAMMLDNGAR KRFAPDDRSG GMSFERRHRR MIKNRESAAR SRARKQAYTV ELEAELGYLK  360
EENARLKAEE GSILMAKKQM IANEMMEKSK ENASAKKGGS RRSNSCIW*
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that possesses transactivation activity in yeast (PubMed:17604002, PubMed:21055780, PubMed:18236009). Involved in abscisic acid (ABA) signaling pathway. Binds to the G-box motif 5'-CACGTG-3' of TRAB1 gene promoter (PubMed:17604002). Involved in the regulation of pollen maturation. May act as negative regulator of salt stress response (PubMed:18236009). Together with PYL5, PP2C30 and SAPK2, is part of an ABA signaling unit that modulates seed germination and early seedling growth (PubMed:22071266). {ECO:0000269|PubMed:17604002, ECO:0000269|PubMed:18236009, ECO:0000269|PubMed:21055780, ECO:0000269|PubMed:22071266}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast01G082600.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by abscisic acid (ABA) (PubMed:21055780, PubMed:18236009, PubMed:22071266). Induced by salt stress. Down-regulated by cold and drought stresses (PubMed:18236009). {ECO:0000269|PubMed:18236009, ECO:0000269|PubMed:21055780, ECO:0000269|PubMed:22071266}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ4167503e-71DQ416750.1 Avena fatua clone 3 ABA response element binding factor (ABF) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003567284.10.0ABSCISIC ACID-INSENSITIVE 5-like protein 1
SwissprotQ8RZ351e-144ABI5_ORYSJ; bZIP transcription factor ABI5 homolog
TrEMBLI1HTK70.0I1HTK7_BRADI; Uncharacterized protein
STRINGBRADI2G55550.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38303558
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G44460.12e-20bZIP family protein
Publications ? help Back to Top
  1. Zou M,Guan Y,Ren H,Zhang F,Chen F
    A bZIP transcription factor, OsABI5, is involved in rice fertility and stress tolerance.
    Plant Mol. Biol., 2008. 66(6): p. 675-83
    [PMID:18236009]
  2. Kim H, et al.
    A rice orthologue of the ABA receptor, OsPYL/RCAR5, is a positive regulator of the ABA signal transduction pathway in seed germination and early seedling growth.
    J. Exp. Bot., 2012. 63(2): p. 1013-24
    [PMID:22071266]
  3. Bhatnagar N, et al.
    The protein phosphatase 2C clade A protein OsPP2C51 positively regulates seed germination by directly inactivating OsbZIP10.
    Plant Mol. Biol., 2017. 93(4-5): p. 389-401
    [PMID:28000033]