PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast01G076300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family bZIP
Protein Properties Length: 263aa    MW: 28057.3 Da    PI: 5.0327
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast01G076300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_146.76.8e-15180235358
                         XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevak 58 
                         + +r++r++kNRe+A rsR+RK+a+i+eLe  v +Le+eN  L  e ee +++  k
  Brast01G076300.1.p 180 AMQRQKRMIKNRESAARSRERKQAYIAELESLVSQLEEENAHLSREQEEQNEKRLK 235
                         689****************************************9888776665544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003389.8E-9178242IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.898180244IPR004827Basic-leucine zipper domain
PfamPF001704.6E-14180240IPR004827Basic-leucine zipper domain
CDDcd147073.24E-19182229No hitNo description
SuperFamilySSF579591.94E-10183230No hitNo description
Gene3DG3DSA:1.20.5.1702.7E-13183232No hitNo description
PROSITE patternPS000360185200IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MASSRVMASS SSPSHTATDL SRFAEAPAGR PGDSGLGSMN VEELLRGIYG DIPTPAPADR  60
PISPVRPAAL ETATRRTADE VWKEITGGGS GEEEEEEVAP AGPAASVVPG AVGGASEMTL  120
EDFLARESAA KEVAVRASGP SAALEEQVAM GFLNGADGAR GGGGGRGKKR QQMDPMDRAA  180
MQRQKRMIKN RESAARSRER KQAYIAELES LVSQLEEENA HLSREQEEQN EKRLKELKEK  240
ATPVIIVKTS SQDLRRTNSM EW*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003564700.11e-123PREDICTED: G-box-binding factor 4-like isoform X2
TrEMBLI1HTR41e-123I1HTR4_BRADI; Uncharacterized protein
STRINGBRADI2G56096.11e-123(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26653786
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G03970.14e-18G-box binding factor 4