PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast01G063400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 396aa    MW: 42737.5 Da    PI: 9.0589
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast01G063400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1609.2e-50321572128
                 NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                         +pGfrFhPt+eel+ +yL++kvegk++++ + i+ +d+y+++Pw+Lp++++ +ekew+f+++rd+ky++g+r+nr+t+sgyWkatg d+ +
  Brast01G063400.1.p  32 MPGFRFHPTEEELIEFYLRRKVEGKRFNV-DLITFLDLYRYDPWELPAMAAIGEKEWFFYVPRDRKYRNGDRPNRVTASGYWKATGADRMI 121
                         79***************************.99***************888889************************************** PP

                 NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                          +++++ +glkktLvfy+g+apkg++++W+m+eyrl
  Brast01G063400.1.p 122 RAESSRPIGLKKTLVFYSGKAPKGVRSSWIMNEYRL 157
                         **********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100555.2131178IPR003441NAC domain
SuperFamilySSF1019419.94E-5631177IPR003441NAC domain
PfamPF023651.3E-2433157IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 396 aa     Download sequence    Send to blast
MSRYEGGGGH GAAALGGGGG TKEDAHEQDL VMPGFRFHPT EEELIEFYLR RKVEGKRFNV  60
DLITFLDLYR YDPWELPAMA AIGEKEWFFY VPRDRKYRNG DRPNRVTASG YWKATGADRM  120
IRAESSRPIG LKKTLVFYSG KAPKGVRSSW IMNEYRLPTA DTHRYHKTEI SLCRVYKRTG  180
IDDGHASSRS TPSSRAATAA RHDNNSNNNN NKQLQQAAGN SSSTSTTPTP PPTPSKLHLL  240
QQGSPECTSQ PLLGYLQQSA AGDHHEQQGA LLQYQQQQYS GTGKSSTSGG AFASTSYSLL  300
SLVNAASVGA AGGASAAAID ELSFSTLVGG SQPAAAAYHG SSQLHHDHFV VPLPTTAPQL  360
PMSLAAISEK MIWDWNPIPD AAAGTRDYGG AGIFK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-54191785165NO APICAL MERISTEM PROTEIN
1ut4_B3e-54191785165NO APICAL MERISTEM PROTEIN
1ut7_A3e-54191785165NO APICAL MERISTEM PROTEIN
1ut7_B3e-54191785165NO APICAL MERISTEM PROTEIN
3swm_A4e-54191788168NAC domain-containing protein 19
3swm_B4e-54191788168NAC domain-containing protein 19
3swm_C4e-54191788168NAC domain-containing protein 19
3swm_D4e-54191788168NAC domain-containing protein 19
3swp_A4e-54191788168NAC domain-containing protein 19
3swp_B4e-54191788168NAC domain-containing protein 19
3swp_C4e-54191788168NAC domain-containing protein 19
3swp_D4e-54191788168NAC domain-containing protein 19
4dul_A3e-54191785165NAC domain-containing protein 19
4dul_B3e-54191785165NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00257DAPTransfer from AT2G02450Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFR8197620.0FR819762.1 Hordeum vulgare subsp. vulgare mRNA for NAC transcription factor (NAC012 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010232667.10.0PREDICTED: NAC domain-containing protein 68
SwissprotQ9FIW53e-64NAC94_ARATH; Putative NAC domain-containing protein 94
TrEMBLI1HU420.0I1HU42_BRADI; Uncharacterized protein
STRINGBRADI2G57297.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28263787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.21e-101NAC domain containing protein 35