PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast01G048500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family M-type_MADS
Protein Properties Length: 389aa    MW: 41329 Da    PI: 5.2165
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast01G048500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF37.62.9e-121149341
                        --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE- CS
              SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifs 41
                        i++ ++r   f+ R+ g+lK A+ELS+LC + vav++ +
  Brast01G048500.1.p 11 ISDRRKRAAAFATRKRGLLKMASELSTLCSVPVAVVLSA 49
                        8999*******************************9866 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554553.4E-14190IPR002100Transcription factor, MADS-box
SMARTSM004322.1E-7161IPR002100Transcription factor, MADS-box
PROSITE profilePS5006615.937147IPR002100Transcription factor, MADS-box
CDDcd002665.38E-16291No hitNo description
PfamPF003191.3E-111150IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 389 aa     Download sequence    Send to blast
MGRGKTRMGL ISDRRKRAAA FATRKRGLLK MASELSTLCS VPVAVVLSAP AAGGPSGAAP  60
PHHHHPPPEV WETEGVLERY RALPAEKRAE HTHLRYLEGN LGKEEAKLAR VLRKGPAALA  120
SPDAELNGMN LDELREVLES VDAALLATAE RKKALGLPEH DDDAAVDGPC TEGGFVGLDG  180
GYYEMEEPVD GRIDHQAIWD ANAMNMMQPG PGYYGFPNMN IAQPACDASG YLLDMAPGIG  240
SNYHGQLAQG AFPYYSHSQH QQQNAIARPA YGGFQYTDGN TGYAGMGSSS QTHQMPSNVD  300
GALTTWRTAE PCNAIVPAGW CPDVFTDNNL YTTAPGYLGM GNGGGAMNYA GCNDALYCSS  360
NDFRCSGSGT TSQNSSNIED LPYLRDGA*
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast01G048500.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014755040.10.0uncharacterized protein LOC104583363
TrEMBLA0A0Q3IZN50.0A0A0Q3IZN5_BRADI; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP45722960