PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast01G041400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family SBP
Protein Properties Length: 400aa    MW: 41717.3 Da    PI: 8.9395
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast01G041400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.21.5e-4071147278
                         -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                 SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                         C vegC+adls+++eyhrrhkvCe+hsk+pvv v+g++qrfCqqCsrfh l efDe krsCr+rL++hn+rrrk+q+
  Brast01G041400.1.p  71 CSVEGCAADLSRCREYHRRHKVCEAHSKTPVVSVAGQQQRFCQQCSRFHLLVEFDEVKRSCRKRLDGHNRRRRKQQP 147
                         **************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.0E-3264132IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.59968145IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.49E-3870149IPR004333Transcription factor, SBP-box
PfamPF031103.6E-2971144IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 400 aa     Download sequence    Send to blast
MDWEAKMPSW DLGTVVGPSG GAGGGLDLKL GGPTSWRPVP AAAAAAAVAP APSSSPAAAK  60
RARAGQAAAA CSVEGCAADL SRCREYHRRH KVCEAHSKTP VVSVAGQQQR FCQQCSRFHL  120
LVEFDEVKRS CRKRLDGHNR RRRKQQPDPL GPAGIFANHH GGTRFASYPQ IFSTVTSMAP  180
EHKWPGSIAV KTEADAFHVE QYYSSLQLNG AANAAASLFG SKERSKRFPF LSDHHGEGAF  240
SCQQPFTITP SSESSSNSSS RHSNGNKMFA ANDGGPDHNC ALSLLSDSPT TQAAHIMIPA  300
AVQAPLGGAR IHYGGGGDGG GGVSLTGLSY ASGIMGDNKS SAHAAMASST RHAGAVTTAS  360
SVAAQLQQYH GYYQQQVNGD QVNSADAGAS MQALPFSSW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-26711441184squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast01G041400.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010232756.10.0squamosa promoter-binding-like protein 2
SwissprotQ0JGI11e-119SPL2_ORYSJ; Squamosa promoter-binding-like protein 2
TrEMBLI1HUP50.0I1HUP5_BRADI; Uncharacterized protein
STRINGBRADI2G59110.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP104563038
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.11e-29SBP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]