PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast01G040300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family M-type_MADS
Protein Properties Length: 151aa    MW: 16986.8 Da    PI: 11.6442
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast01G040300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF79.91.7e-2596145251
                         ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF   2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 
                         rie+ + rqv fskRr+g++KKA+EL  LCdaeva+++fs+ g+lyeyss
  Brast01G040300.1.p  96 RIEDRTSRQVRFSKRRAGLFKKAFELALLCDAEVALLVFSPAGRLYEYSS 145
                         8***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.4E-3287146IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.11487147IPR002100Transcription factor, MADS-box
CDDcd002653.49E-3388147No hitNo description
PRINTSPR004047.0E-2789109IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.7E-2589147IPR002100Transcription factor, MADS-box
PfamPF003198.2E-2596143IPR002100Transcription factor, MADS-box
PRINTSPR004047.0E-27109124IPR002100Transcription factor, MADS-box
PRINTSPR004047.0E-27124145IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 151 aa     Download sequence    Send to blast
MAMFQIPRVK KSFCSIENLI GKKTDFLLEL GGPPRSAPRP SLLSDPLARP TLRWSAPFLL  60
SSLACHARVR EGERRSSDGG RRCVRMARRG RVELRRIEDR TSRQVRFSKR RAGLFKKAFE  120
LALLCDAEVA LLVFSPAGRL YEYSSSSRCS *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-1689147361Myocyte-specific enhancer factor 2B
1tqe_Q2e-1689147361Myocyte-specific enhancer factor 2B
1tqe_R2e-1689147361Myocyte-specific enhancer factor 2B
1tqe_S2e-1689147361Myocyte-specific enhancer factor 2B
6c9l_A2e-1689147361Myocyte-specific enhancer factor 2B
6c9l_B2e-1689147361Myocyte-specific enhancer factor 2B
6c9l_C2e-1689147361Myocyte-specific enhancer factor 2B
6c9l_D2e-1689147361Myocyte-specific enhancer factor 2B
6c9l_E2e-1689147361Myocyte-specific enhancer factor 2B
6c9l_F2e-1689147361Myocyte-specific enhancer factor 2B
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast01G040300.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4693342e-85KF469334.1 Brachypodium distachyon MADS-box transcription factor 40 mRNA, complete cds.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12938398
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G11880.14e-24AGAMOUS-like 14