PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast01G031100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family HB-other
Protein Properties Length: 1162aa    MW: 127470 Da    PI: 7.3529
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast01G031100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox20.86.7e-0771127157
                         TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
            Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                         +++R  ++++ ++++++ F+ + ++ ++e +e+++ +g+t +qV+ +F  +R++ +k
  Brast01G031100.1.p  71 KKPRDLLNPKAVKIMQSIFALKDNIGKRETREISALCGVTVTQVREFFASQRTRVRK 127
                         799***************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.10268128IPR001356Homeobox domain
SMARTSM003892.1E-470132IPR001356Homeobox domain
CDDcd000863.80E-571127No hitNo description
PfamPF000461.9E-471127IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.7E-671134IPR009057Homeodomain-like
SuperFamilySSF466897.7E-771131IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1162 aa     Download sequence    Send to blast
MDLVPFKPVA GALAKAVGGG SIPAMVAAQQ EQLHAQVDQL QRLVVAQCRL TGVNPLAQEM  60
AAGALSIKIG KKPRDLLNPK AVKIMQSIFA LKDNIGKRET REISALCGVT VTQVREFFAS  120
QRTRVRKVVR LSREKALKIE PSEATDSVCS MSTEQTPVDI EAHAQLVEPL RTLEPLEMSQ  180
SSSQLVEVPQ NSLQQAEVQQ SYATPTTHSG TMQPTDGKIN PDLAQKETKP EEVAAGVESE  240
DKKFLESIFA RMRKEETFSG QVKLMEWILQ INNVTILGWF LTMGGLPIVS TWLSQAATEE  300
QTTVILVIFK VLLHLPLHKA LPAHMSAVLQ TINRLRFYRT QDISSRARNL LSRLSKVLVR  360
SQASKKPQKD LICKQRISEI LRDESWRSEV DITDEILALT EGASESRKPE PRKTPLLLTA  420
SADEPYKKSS VQPRSKERRK VLFVEHPNRK ATGNNVHSVR SISTNSSRPL SADDIQKAKM  480
RAMFMQEKYG KRDTGKGTDK SEMVEIQKPS GLVNSDVLPM PRSPPMSTTK QPVEPSPSTS  540
KQNTVPLPDK PEIPVSPKLN ITPRENSREK LDSKRVIWQI PPEVWIDPSW TVSAGENSKE  600
LDVQTQRNRR EKETFYASLN DIPLNPKDPW DLEMDFDDSL TPEIPIDQPS DAGIMEVDNV  660
GAAPSNICFP DENNYAGSTS SSTVAAGANG AAAEPDLELL AVLLKNPQLV FALSSNQMGT  720
LPNEQTVALL DMLKQTGLGL PELVNGLANG TGVPKASEPG PEAIPTSLPS PTPPEDLPAS  780
ASWRSEFPTQ VRASNLQQAH LPSRGNTSLV ASTMHQSFSN VVSPLPSQPY TSISASPAHI  840
QTNILSSPQL AVSVNALNQH VAPVNDLLNG PVVHRHAQSY ALASDAAVGA IQQHPAVNKP  900
AHEFQNISNP ALAPAWQSSA ANLASTGRNT TPEPWASHTT NSFNDASMPY LNQSAYSNQS  960
TQSPYNAYAS TSVSSQGLDR NGYTRTAEYQ VSGCDTHQRH SLSPEPGAAR VYGGTQAYIP  1020
EPLNVGNYGQ QSYNPETSRD WRSGQQSHAA AEPSSQWSSI QQSYPPAEPS RQWSSGQQSY  1080
VPPEASTQWS SGQQNYNQSD ISRQWSSAQQ TYTRAEPSRP SWNTANQGQV PDTSRQWSLR  1140
NQDYYNPNDG RSSYDQRQRR R*
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast01G031100.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010232788.10.0homeobox protein LUMINIDEPENDENS
TrEMBLA0A0Q3RDX00.0A0A0Q3RDX0_BRADI; Uncharacterized protein
STRINGBRADI2G59937.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP80433034
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02560.21e-154HB-other family protein