PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009152040.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 121aa    MW: 13593.8 Da    PI: 8.689
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009152040.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260125.13.3e-3951041100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+C+kdC+++pyfp  +p kfa++h+++Ga nv+k+l++lp ++r +a++sl +eA++r++dPvyG+vg+i+ lq +++++++ la
  XP_009152040.1   5 RCAACKYLRRRCPKDCIFSPYFPPGDPDKFACIHRIYGAGNVSKMLQQLPVQTRAEAVESLSFEAKCRVEDPVYGCVGIISLLQTEIQKTQTLLA 99 
                     6*******************************************************************************************999 PP

          DUF260  96 llkee 100
                     ++++e
  XP_009152040.1 100 RTQAE 104
                     99887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.4994105IPR004883Lateral organ boundaries, LOB
PfamPF031951.9E-385102IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016020Cellular Componentmembrane
Sequence ? help Back to Top
Protein Sequence    Length: 121 aa     Download sequence    Send to blast
MNPKRCAACK YLRRRCPKDC IFSPYFPPGD PDKFACIHRI YGAGNVSKML QQLPVQTRAE  60
AVESLSFEAK CRVEDPVYGC VGIISLLQTE IQKTQTLLAR TQAEIAVAQA KHSQTQVNEF  120
M
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00381DAPTransfer from AT3G26620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0566091e-109DQ056609.1 Arabidopsis thaliana putative LOB domain protein (At3g26620) mRNA, complete cds.
GenBankAB4738471e-109AB473847.1 Arabidopsis thaliana ASL14 mRNA for ASYMMETRIC LEAVES2-like 14 protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013644728.15e-87PREDICTED: LOB domain-containing protein 23-like
RefseqXP_009152040.15e-87PREDICTED: LOB domain-containing protein 23
SwissprotP594673e-75LBD23_ARATH; LOB domain-containing protein 23
SwissprotP594683e-75LBD24_ARATH; LOB domain-containing protein 24
TrEMBLA0A078FKY46e-87A0A078FKY4_BRANA; BnaA06g32760D protein
STRINGAT3G26620.17e-73(Arabidopsis thaliana)
STRINGAT3G26660.19e-73(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26620.12e-76LOB domain-containing protein 23