PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009151152.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family M-type_MADS
Protein Properties Length: 203aa    MW: 22776.2 Da    PI: 8.8966
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009151152.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF59.34.9e-191054246
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEE CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgkl 46
                     ien++ r++tf kR+ gi+KKA ELS+LCd+ +av + s+ + +
  XP_009151152.1 10 YIENETSRKTTFRKRKGGIMKKALELSTLCDVPIAVFVQSEYNSV 54
                    59**************************************98876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554551.83E-23186IPR002100Transcription factor, MADS-box
SMARTSM004323.2E-25160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006620.353161IPR002100Transcription factor, MADS-box
CDDcd002663.69E-24286No hitNo description
PRINTSPR004041.8E-13323IPR002100Transcription factor, MADS-box
PfamPF003194.3E-171153IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-132338IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-133859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MTRNRVKMAY IENETSRKTT FRKRKGGIMK KALELSTLCD VPIAVFVQSE YNSVPEVFPP  60
SRQAMGNMLV KWEKLSLVEK TKKMMNQEQF IQQRITKATE SCKKVAKENK ELAMKEVMYD  120
CLRGDNAPCN LDEDELRDLG GVIDQYIKGL NRRIQVLMKD HASSSTSVVP DAAAAAAAVA  180
MPTAEMGSSS NVKDFDLNQT QSE
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_009151152.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009151152.11e-151PREDICTED: MADS-box transcription factor PHERES 2
RefseqXP_013647266.11e-151MADS-box transcription factor PHERES 2-like
TrEMBLA0A397Z1M11e-150A0A397Z1M1_BRACM; Uncharacterized protein
TrEMBLM4D0B51e-150M4D0B5_BRARP; Uncharacterized protein
STRINGBra009913.1-P1e-150(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26630.17e-54M-type_MADS family protein