PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009151151.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family M-type_MADS
Protein Properties Length: 364aa    MW: 41440.7 Da    PI: 5.4021
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009151151.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF45.51e-141148340
                    --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE CS
          SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviif 40
                    i +k+ r +tf kR+ gi+KK +EL +LC++e++ +++
  XP_009151151.1 11 IPDKTSRRTTFKKRKGGIMKKLHELVTLCGVEACAVVY 48
                    7899*****************************97776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006616.778161IPR002100Transcription factor, MADS-box
SMARTSM004327.4E-17161IPR002100Transcription factor, MADS-box
CDDcd002663.06E-29384No hitNo description
PRINTSPR004046.4E-9323IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.22E-21396IPR002100Transcription factor, MADS-box
PfamPF003192.2E-151152IPR002100Transcription factor, MADS-box
PRINTSPR004046.4E-92338IPR002100Transcription factor, MADS-box
PRINTSPR004046.4E-93859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MVRSRVKLSL IPDKTSRRTT FKKRKGGIMK KLHELVTLCG VEACAVVYNG PNDANPEAWP  60
SREGAEEVIS KFMGFPRVER EKKMYDQERY TGERIMKEEA TLERVKDENR ELELKEIMFD  120
LLKGKRMMEH HFSDARVVNE LCEFIDYNVS EITKRIHMLQ ANGGTVSFPP LDVGAVDAAH  180
PAVGDVNPIA GADVAAVTMP YGFNFGHIQN MNVNQQAPAY LNDHIPYQNM NQQALFHNQV  240
PTNFSGHVPY QNMMNYQEPV QYQVPDNVYD QNQNGFNGLN QGMGLDMNHN LSESFSQYPN  300
LHDQPYLNQL MAQTQQMSYA EELASLAAMD NNNYQLPSTS YMPSMELSAL NTNNNPWPTR  360
FGLE
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_009151151.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009151151.10.0PREDICTED: MADS-box transcription factor PHERES 2
TrEMBLM4D0B30.0M4D0B3_BRARP; Uncharacterized protein
STRINGBra009911.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26650.15e-48AGAMOUS-like 36