PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009150115.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LFY
Protein Properties Length: 413aa    MW: 45988.7 Da    PI: 7.0167
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009150115.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY618.81e-18813901386
         FLO_LFY   1 mdpeafsaslfkwdpraaaaapparlleeaavseapleaaaaaaarklreleelfkayGvryltvakiaelGftvstLvdmkdeelddlmkslse 95 
                     mdpe f++ lf+w+p  a++++p+ + + ++++++p++ ++aa  ++l +le lf  yGvr++t+akiaelGft+stLv+mkdeel+d+m+sls+
  XP_009150115.1   1 MDPEGFTSGLFRWNPTRAMVQAPTAIPPPQQQQQSPATPQTAAFGMRLGGLEGLFGPYGVRFYTAAKIAELGFTASTLVGMKDEELEDMMNSLSH 95 
                     9*************98888888889999999999998888888888899********************************************** PP

         FLO_LFY  96 ifrldllvGeryGikaavraerrrlee..eeaekkrrkll...sedeet..aldalsqeglseepvqeekeaagsggeglgeaelvaaeekksee 183
                     ifr++llvGeryGikaavraerrrl+e  ee++++rr+ll   + d+ t  aldalsqeglseepvq++ ++ ++g +  g+ +   a ++   +
  XP_009150115.1  96 IFRWELLVGERYGIKAAVRAERRRLQEeeEEESSRRRHLLlsaAGDSGThlALDALSQEGLSEEPVQHQDHTDAAGINCGGRGGHWEAGQT---T 187
                     *************************995444567778877787455544569**************9976655554444344444444322...2 PP

         FLO_LFY 184 ekkkaskkkqkrkkkkelkseededeeeeededeeg...sgedgeerqrehPfivtepgevargkknGLDYLfdLyeqCrefLlqvqkiakerGe 275
                      kk++ + ++++k   + + e+d+d +e ed+d+++   ++ +g+erqrehPfivtepgevargkknGLDYLf+LyeqCrefLlqvq+iak+rGe
  XP_009150115.1 188 IKKQQ-Q-RRRKKAIVT-SVETDDDGNEGEDDDGMDivnGSGSGMERQREHPFIVTEPGEVARGKKNGLDYLFHLYEQCREFLLQVQTIAKDRGE 279
                     22222.2.233333333.334444544444444444443667799************************************************** PP

         FLO_LFY 276 kcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykplvaiaarqgwdidavfnahprLsiWYv 370
                     kcPtkvtnqvfryakk+ga+yinkPkmrhYvhCYalhcLdeeasnalrr+fkergenvG+wrqacykplv+ia r+gwdidavfnahprLsiWYv
  XP_009150115.1 280 KCPTKVTNQVFRYAKKSGANYINKPKMRHYVHCYALHCLDEEASNALRRTFKERGENVGSWRQACYKPLVDIACRHGWDIDAVFNAHPRLSIWYV 374
                     *********************************************************************************************** PP

         FLO_LFY 371 PtkLrqLChlerskas 386
                     PtkLrqLChler++a+
  XP_009150115.1 375 PTKLRQLCHLERNNAV 390
                     ************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016982.9E-1971389IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 413 aa     Download sequence    Send to blast
MDPEGFTSGL FRWNPTRAMV QAPTAIPPPQ QQQQSPATPQ TAAFGMRLGG LEGLFGPYGV  60
RFYTAAKIAE LGFTASTLVG MKDEELEDMM NSLSHIFRWE LLVGERYGIK AAVRAERRRL  120
QEEEEEESSR RRHLLLSAAG DSGTHLALDA LSQEGLSEEP VQHQDHTDAA GINCGGRGGH  180
WEAGQTTIKK QQQRRRKKAI VTSVETDDDG NEGEDDDGMD IVNGSGSGME RQREHPFIVT  240
EPGEVARGKK NGLDYLFHLY EQCREFLLQV QTIAKDRGEK CPTKVTNQVF RYAKKSGANY  300
INKPKMRHYV HCYALHCLDE EASNALRRTF KERGENVGSW RQACYKPLVD IACRHGWDID  360
AVFNAHPRLS IWYVPTKLRQ LCHLERNNAV AAAAALVGGI SCEGSSASGR FGV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A1e-1262284132187PROTEIN LEAFY
2vy2_A1e-1262284132187PROTEIN LEAFY
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed at an early stage of floral initiation.
UniprotTISSUE SPECIFICITY: Expressed uniformly throughout the young floral primordia.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that promotes early floral meristem identity in synergy with APETALA1. Is required subsequently for the transition of an inflorescence meristem into a floral meristem, by an immediate upstream regulation of the ABC classes of floral homeotic genes. Activates directly APETALA1, CAULIFLOWER and AGAMOUS, and indirectly APETALA3 and PISTILLATA with the cooperation of UFO. {ECO:0000269|PubMed:8565821, ECO:0000269|PubMed:9783581, ECO:0000269|Ref.6}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_009150115.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Positively regulated by CAULIFLOWER and APETALA1. Down-regulated by TFL1.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKR8177990.0KR817799.1 Brassica juncea cultivar Varuna LEAFY (LFY) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009150115.10.0PREDICTED: putative transcription factor BOFH isoform X2
SwissprotQ009580.0LFY_ARATH; Protein LEAFY
TrEMBLM4DSX60.0M4DSX6_BRARP; Uncharacterized protein
STRINGBra019619.1-P0.0(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.10.0floral meristem identity control protein LEAFY (LFY)
Publications ? help Back to Top
  1. Chao WS,Doğramaci M,Foley ME,Horvath DP,Anderson JV
    Selection and validation of endogenous reference genes for qRT-PCR analysis in leafy spurge (Euphorbia esula).
    PLoS ONE, 2012. 7(8): p. e42839
    [PMID:22916167]
  2. Yang C, et al.
    VAL- and AtBMI1-mediated H2Aub initiate the switch from embryonic to postgerminative growth in Arabidopsis.
    Curr. Biol., 2013. 23(14): p. 1324-9
    [PMID:23810531]
  3. Lei HJ, et al.
    Identification and characterization of FaSOC1, a homolog of SUPPRESSOR OF OVEREXPRESSION OF CONSTANS1 from strawberry.
    Gene, 2013. 531(2): p. 158-67
    [PMID:24055423]
  4. Yu Y, et al.
    MlWRKY12, a novel Miscanthus transcription factor, participates in pith secondary cell wall formation and promotes flowering.
    Plant Sci., 2013. 212: p. 1-9
    [PMID:24094048]
  5. Niwa M,Endo M,Araki T
    Florigen is involved in axillary bud development at multiple stages in Arabidopsis.
    Plant Signal Behav, 2013. 8(11): p. e27167
    [PMID:24305631]
  6. Fu J, et al.
    Photoperiodic control of FT-like gene ClFT initiates flowering in Chrysanthemum lavandulifolium.
    Plant Physiol. Biochem., 2014. 74: p. 230-8
    [PMID:24316581]
  7. Risseeuw E, et al.
    An activated form of UFO alters leaf development and produces ectopic floral and inflorescence meristems.
    PLoS ONE, 2013. 8(12): p. e83807
    [PMID:24376756]
  8. Yang Z, et al.
    Analyses of sequence polymorphism and haplotype diversity of LEAFY genes revealed post-domestication selection in the Chinese elite maize inbred lines.
    Mol. Biol. Rep., 2014. 41(2): p. 1117-25
    [PMID:24381105]
  9. Chandler JW,Werr W
    Arabidopsis floral phytomer development: auxin response relative to biphasic modes of organ initiation.
    J. Exp. Bot., 2014. 65(12): p. 3097-110
    [PMID:24744428]
  10. Yamaguchi N, et al.
    Gibberellin acts positively then negatively to control onset of flower formation in Arabidopsis.
    Science, 2014. 344(6184): p. 638-41
    [PMID:24812402]
  11. Leal Valentim F, et al.
    A quantitative and dynamic model of the Arabidopsis flowering time gene regulatory network.
    PLoS ONE, 2015. 10(2): p. e0116973
    [PMID:25719734]
  12. Chen Z, et al.
    Overexpression of AtAP1M3 regulates flowering time and floral development in Arabidopsis and effects key flowering-related genes in poplar.
    Transgenic Res., 2015. 24(4): p. 705-15
    [PMID:25820621]
  13. Müller-Xing R,Schubert D,Goodrich J
    Non-inductive conditions expose the cryptic bract of flower phytomeres in Arabidopsis thaliana.
    Plant Signal Behav, 2015. 10(4): p. e1010868
    [PMID:25924005]
  14. Ma X, et al.
    CYCLIN-DEPENDENT KINASE G2 regulates salinity stress response and salt mediated flowering in Arabidopsis thaliana.
    Plant Mol. Biol., 2015. 88(3): p. 287-99
    [PMID:25948280]
  15. Wang C,Dehesh K
    From retrograde signaling to flowering time.
    Plant Signal Behav, 2015. 10(6): p. e1022012
    [PMID:26098376]
  16. Kusters E,Della Pina S,Castel R,Souer E,Koes R
    Changes in cis-regulatory elements of a key floral regulator are associated with divergence of inflorescence architectures.
    Development, 2015. 142(16): p. 2822-31
    [PMID:26220938]
  17. Andrés F, et al.
    Floral Induction in Arabidopsis by FLOWERING LOCUS T Requires Direct Repression of BLADE-ON-PETIOLE Genes by the Homeodomain Protein PENNYWISE.
    Plant Physiol., 2015. 169(3): p. 2187-99
    [PMID:26417007]
  18. Yamaguchi N,Jeong CW,Nole-Wilson S,Krizek BA,Wagner D
    AINTEGUMENTA and AINTEGUMENTA-LIKE6/PLETHORA3 Induce LEAFY Expression in Response to Auxin to Promote the Onset of Flower Formation in Arabidopsis.
    Plant Physiol., 2016. 170(1): p. 283-93
    [PMID:26537561]
  19. Yu Y, et al.
    WRKY71 accelerates flowering via the direct activation of FLOWERING LOCUS T and LEAFY in Arabidopsis thaliana.
    Plant J., 2016. 85(1): p. 96-106
    [PMID:26643131]
  20. Fu X, et al.
    CHD3 chromatin-remodeling factor PICKLE regulates floral transition partially via modulating LEAFY expression at the chromatin level in Arabidopsis.
    Sci China Life Sci, 2016. 59(5): p. 516-28
    [PMID:27056257]
  21. Yamaguchi N,Wu MF,Winter CM,Wagner D
    LEAFY and Polar Auxin Transport Coordinately Regulate Arabidopsis Flower Development.
    Plants (Basel), 2014. 3(2): p. 251-65
    [PMID:27135503]
  22. Xu C,Yu Y,Zhang Y,Li Y,Wei S
    Gibberellins are involved in effect of near-null magnetic field on Arabidopsis flowering.
    Bioelectromagnetics, 2017. 38(1): p. 1-10
    [PMID:27598690]
  23. Tang M, et al.
    An ortholog of LEAFY in Jatropha curcas regulates flowering time and floral organ development.
    Sci Rep, 2016. 6: p. 37306
    [PMID:27869146]
  24. Wendell M, et al.
    Thermoperiodic Control of Floral Induction Involves Modulation of the Diurnal FLOWERING LOCUS T Expression Pattern.
    Plant Cell Physiol., 2017. 58(3): p. 466-477
    [PMID:28028164]
  25. Monniaux M, et al.
    Conservation vs divergence in LEAFY and APETALA1 functions between Arabidopsis thaliana and Cardamine hirsuta.
    New Phytol., 2017. 216(2): p. 549-561
    [PMID:28098947]
  26. Guo WY,Cui YM,Wang TT,Yu DY,Huang F
    Functional analysis of flower development related gene GsLFY from Glycine soja.
    Yi Chuan, 2017. 39(1): p. 56-65
    [PMID:28115306]
  27. Dhakate P,Tyagi S,Singh A,Singh A
    Functional characterization of a novel Brassica LEAFY homolog from Indian mustard: Expression pattern and gain-of-function studies.
    Plant Sci., 2017. 258: p. 29-44
    [PMID:28330561]
  28. Yang T,Du MF,Guo YH,Liu X
    Two LEAFY homologs ILFY1 and ILFY2 control reproductive and vegetative developments in Isoetes L.
    Sci Rep, 2017. 7(1): p. 225
    [PMID:28331204]
  29. Goslin K, et al.
    Transcription Factor Interplay between LEAFY and APETALA1/CAULIFLOWER during Floral Initiation.
    Plant Physiol., 2017. 174(2): p. 1097-1109
    [PMID:28385730]
  30. Serrano-Mislata A, et al.
    Regulatory interplay between LEAFY, APETALA1/CAULIFLOWER and TERMINAL FLOWER1: New insights into an old relationship.
    Plant Signal Behav, 2017. 12(10): p. e1370164
    [PMID:28873010]
  31. Zhang GZ, et al.
    Ectopic expression of UGT84A2 delayed flowering by indole-3-butyric acid-mediated transcriptional repression of ARF6 and ARF8 genes in Arabidopsis.
    Plant Cell Rep., 2017. 36(12): p. 1995-2006
    [PMID:29027578]
  32. Zhao W, et al.
    CsLFY is required for shoot meristem maintenance via interaction with WUSCHEL in cucumber (Cucumis sativus).
    New Phytol., 2018. 218(1): p. 344-356
    [PMID:29274285]
  33. Dotto M,Gómez MS,Soto MS,Casati P
    UV-B radiation delays flowering time through changes in the PRC2 complex activity and miR156 levels in Arabidopsis thaliana.
    Plant Cell Environ., 2018. 41(6): p. 1394-1406
    [PMID:29447428]
  34. Kumar A,Singh A,Panigrahy M,Sahoo PK,Panigrahi KCS
    Carbon nanoparticles influence photomorphogenesis and flowering time in Arabidopsis thaliana.
    Plant Cell Rep., 2018. 37(6): p. 901-912
    [PMID:29541883]