PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009150114.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LFY
Protein Properties Length: 417aa    MW: 46506.2 Da    PI: 6.7464
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009150114.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY610.82.7e-18613941386
         FLO_LFY   1 mdpeafsaslfkwdpraaaaapparlleeaavseapleaaaaaaarklreleelfkayGvryltvakiaelGftvstLvdmkdeelddlmkslse 95 
                     mdpe f++ lf+w+p  a++++p+ + + ++++++p++ ++aa  ++l +le lf  yGvr++t+akiaelGft+stLv+mkdeel+d+m+sls+
  XP_009150114.1   1 MDPEGFTSGLFRWNPTRAMVQAPTAIPPPQQQQQSPATPQTAAFGMRLGGLEGLFGPYGVRFYTAAKIAELGFTASTLVGMKDEELEDMMNSLSH 95 
                     9*************98888888889999999999998888888888899********************************************** PP

         FLO_LFY  96 ifrldllvGeryGikaavraerrrlee..eeaekkrrkll...sedeet..aldalsqe....glseepvqeekeaagsggeglgeaelvaaeek 179
                     ifr++llvGeryGikaavraerrrl+e  ee++++rr+ll   + d+ t  aldalsqe    glseepvq++ ++ ++g +  g+ +   a ++
  XP_009150114.1  96 IFRWELLVGERYGIKAAVRAERRRLQEeeEEESSRRRHLLlsaAGDSGThlALDALSQEddwtGLSEEPVQHQDHTDAAGINCGGRGGHWEAGQT 190
                     *************************995444567778877787455544569******988889******9976655554444344444443322 PP

         FLO_LFY 180 kseeekkkaskkkqkrkkkkelkseededeeeeededeeg...sgedgeerqrehPfivtepgevargkknGLDYLfdLyeqCrefLlqvqkiak 271
                        + kk++ + ++++k   + + e+d+d +e ed+d+++   ++ +g+erqrehPfivtepgevargkknGLDYLf+LyeqCrefLlqvq+iak
  XP_009150114.1 191 ---TIKKQQ-Q-RRRKKAIVT-SVETDDDGNEGEDDDGMDivnGSGSGMERQREHPFIVTEPGEVARGKKNGLDYLFHLYEQCREFLLQVQTIAK 279
                     ...222222.2.233333333.334445544444444444443667799********************************************** PP

         FLO_LFY 272 erGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykplvaiaarqgwdidavfnahprLs 366
                     +rGekcPtkvtnqvfryakk+ga+yinkPkmrhYvhCYalhcLdeeasnalrr+fkergenvG+wrqacykplv+ia r+gwdidavfnahprLs
  XP_009150114.1 280 DRGEKCPTKVTNQVFRYAKKSGANYINKPKMRHYVHCYALHCLDEEASNALRRTFKERGENVGSWRQACYKPLVDIACRHGWDIDAVFNAHPRLS 374
                     *********************************************************************************************** PP

         FLO_LFY 367 iWYvPtkLrqLChlerskas 386
                     iWYvPtkLrqLChler++a+
  XP_009150114.1 375 IWYVPTKLRQLCHLERNNAV 394
                     ****************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016982.0E-1951393IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 417 aa     Download sequence    Send to blast
MDPEGFTSGL FRWNPTRAMV QAPTAIPPPQ QQQQSPATPQ TAAFGMRLGG LEGLFGPYGV  60
RFYTAAKIAE LGFTASTLVG MKDEELEDMM NSLSHIFRWE LLVGERYGIK AAVRAERRRL  120
QEEEEEESSR RRHLLLSAAG DSGTHLALDA LSQEDDWTGL SEEPVQHQDH TDAAGINCGG  180
RGGHWEAGQT TIKKQQQRRR KKAIVTSVET DDDGNEGEDD DGMDIVNGSG SGMERQREHP  240
FIVTEPGEVA RGKKNGLDYL FHLYEQCREF LLQVQTIAKD RGEKCPTKVT NQVFRYAKKS  300
GANYINKPKM RHYVHCYALH CLDEEASNAL RRTFKERGEN VGSWRQACYK PLVDIACRHG  360
WDIDAVFNAH PRLSIWYVPT KLRQLCHLER NNAVAAAAAL VGGISCEGSS ASGRFGV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A1e-1262324172187PROTEIN LEAFY
2vy2_A1e-1262324172187PROTEIN LEAFY
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed at an early stage of floral initiation.
UniprotTISSUE SPECIFICITY: Acts in the floral primordia.
Functional Description ? help Back to Top
Source Description
UniProtControls floral meristem identity. Is required very early in flower development and may act here as a transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_009150114.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKR8177990.0KR817799.1 Brassica juncea cultivar Varuna LEAFY (LFY) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009150114.10.0PREDICTED: putative transcription factor BOFH isoform X1
SwissprotQ055360.0BOFH_BRAOB; Putative transcription factor BOFH
TrEMBLA0A172QDM90.0A0A172QDM9_BRAJU; LEAFY protein
TrEMBLA0A1B0XS010.0A0A1B0XS01_BRACM; LEAFY protein
STRINGBra019619.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79072841
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.10.0floral meristem identity control protein LEAFY (LFY)