PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009149579.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family SBP
Protein Properties Length: 1031aa    MW: 113993 Da    PI: 8.1891
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009149579.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP127.45.4e-40129206178
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                     +Cqv++C++dls+ k+yhrrhkvCevhska+++lv +++qrfCqqCsrfh lsefDe+krsCrrrLa+hn+rrrk+++
  XP_009149579.1 129 VCQVDNCSQDLSHGKDYHRRHKVCEVHSKATKALVGKQMQRFCQQCSRFHLLSEFDEGKRSCRRRLAGHNRRRRKTTQ 206
                     6**************************************************************************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.4E-32123191IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.821127204IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.57E-36128206IPR004333Transcription factor, SBP-box
PfamPF031103.2E-28130203IPR004333Transcription factor, SBP-box
Gene3DG3DSA:1.25.40.202.6E-8785933IPR020683Ankyrin repeat-containing domain
CDDcd002043.88E-10785919No hitNo description
SuperFamilySSF484031.67E-8788927IPR020683Ankyrin repeat-containing domain
PROSITE profilePS5029710.285828938IPR020683Ankyrin repeat-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042742Biological Processdefense response to bacterium
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1031 aa     Download sequence    Send to blast
MEEVGAQVAA PLFIHQSLSP MGRKRNLYHH QMPNRLVPPQ PEQRRDEWNS NMWDWDSRRF  60
EAKPVDAEAL RLGSQTQFDL TSRKVGEERG LDLNLGSCLN AAEEETAQAA RPSKKGRSGS  120
PGSGGNYPVC QVDNCSQDLS HGKDYHRRHK VCEVHSKATK ALVGKQMQRF CQQCSRFHLL  180
SEFDEGKRSC RRRLAGHNRR RRKTTQPEEV ASGVVAPGNR DSTSNANMDL MALLTALACA  240
QGKNEVRPIG SPAVPQREQL LQILNKINAL PLPMDLVSKL NSIGSLARKN TDHPVANPQN  300
DVNGASPSTM DLLAVLSETL GSSSPDTLAI LSQGGFGTKE NDKAKLSSYD HVATANLEKR  360
TVGGERSSSS NQSPSQDSDS HAQDTRSSLS LQLFTSSPED ESRRPAVASS RKYYSSASSN  420
PVEDRSPSSS PVMQELFPLQ RSPETMRSKN HNNTSPVRTG GCLPLDLFGA SNRGDANPNF  480
KGFGQQCGYA SSGSDYSPPS LNSDAQDRTG KIVFKLLDKD PSQLPGTLRT EIYNWLSSIP  540
SEMESYIRPG CVVLSVYVAM SPAAWEQLEQ NLQQRVAVML QDSHSGFWRD SRFIVNTGRQ  600
LASHKNGRIR CSKSWRTWNS PELISVSPVA VVAGEETSLV IRGRSLTNDG ISIRCTDMGS  660
YMSMEATGAA CKRAMFDELN VKCFRVNNAQ PGFLGRCFIE VENGFRGDSF PLIIANASIC  720
KELNRLEEEF HPKSQEQAQT SDHRPTSREE ILCFLNELGW LFQKNQTTEP LEQSEFSLSR  780
FKFLLVCSVE RDYCAVIRTL LDMLVERNVV NDEPNREALD MLAEIQLLNR AVKKKSTKMV  840
ELLIHYSVNL GSSKKLVFLP NITGPGGITP LHLAACTSDS DDMVDLLTND PQEIGLSSWN  900
SLCDATGQTP YSYAAMRNNH TYNSLVARKL ADKRNKQVSL NIESEIVVDQ LGVSRRSSTE  960
LNKSSCVSCA TVALKYRRRA SGSHRLFPTP IIHSMLAVAT VCVCVCVFMH AFPIVRQGSH  1020
FSWGGLDYGS I
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-30119203184squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bra.248850.0leaf| silique
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00155DAPTransfer from AT1G20980Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3535540.0AK353554.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-52-I08.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009149579.10.0PREDICTED: squamosa promoter-binding-like protein 14
RefseqXP_013642268.10.0PREDICTED: squamosa promoter-binding-like protein 14
SwissprotQ8RY950.0SPL14_ARATH; Squamosa promoter-binding-like protein 14
TrEMBLA0A078GWF80.0A0A078GWF8_BRANA; BnaA06g14810D protein
TrEMBLM4EAQ40.0M4EAQ4_BRARP; Uncharacterized protein
STRINGBra025863.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM39992554
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20980.10.0squamosa promoter binding protein-like 14