PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009149550.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family WOX
Protein Properties Length: 203aa    MW: 22863.2 Da    PI: 5.3417
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009149550.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.19.6e-2178138257
                     T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
        Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                     r+R+t+t++ql++Le+ +e+ + +p++++++e+A++l    ++te++V++WFqNrRa+ k+
  XP_009149550.1  78 RNRWTPTSTQLQILESIYEEkSGTPNRRRIREIAAELsehgQITETNVYNWFQNRRARSKR 138
                     89*****************9899************************************97 PP

2Wus_type_Homeobox971.5e-3177140265
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        +r+RWtPt++Q++iLe++y++   tPn+++i++i+aeL+e+G+i+++NV++WFQNr+aR+++kq
     XP_009149550.1  77 TRNRWTPTSTQLQILESIYEEKSGTPNRRRIREIAAELSEHGQITETNVYNWFQNRRARSKRKQ 140
                        689***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-1671143IPR009057Homeodomain-like
PROSITE profilePS5007115.04674139IPR001356Homeobox domain
SuperFamilySSF466891.37E-1876143IPR009057Homeodomain-like
SMARTSM003893.0E-1476143IPR001356Homeobox domain
CDDcd000866.55E-1578140No hitNo description
PfamPF000461.9E-1878138IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001944Biological Processvasculature development
GO:0010072Biological Processprimary shoot apical meristem specification
GO:0051301Biological Processcell division
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MERENQNGAY VGRGVMTEEQ METLRKQIAV YSVICEQLAL LHNSLSSFHP LSSGINPNGD  60
GYFNPMVASS SAQRISTRNR WTPTSTQLQI LESIYEEKSG TPNRRRIREI AAELSEHGQI  120
TETNVYNWFQ NRRARSKRKQ PQTIATTDQA EDAAVTTDEK RSCGDSGGFE SYEHILFPSP  180
DLGIEHLLSR GELSGDFNSY TID
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1131139RRARSKRKQ
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_009149550.1
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1892470.0AC189247.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB018K09, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009149550.11e-151PREDICTED: WUSCHEL-related homeobox 14-like
SwissprotQ9LM841e-114WOX14_ARATH; WUSCHEL-related homeobox 14
TrEMBLA0A397YXH01e-150A0A397YXH0_BRACM; Uncharacterized protein
TrEMBLM4EAN01e-150M4EAN0_BRARP; Uncharacterized protein
STRINGBra025839.1-P1e-151(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122111732
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20700.11e-117WUSCHEL related homeobox 14
Publications ? help Back to Top
  1. Denis E, et al.
    WOX14 promotes bioactive gibberellin synthesis and vascular cell differentiation in Arabidopsis.
    Plant J., 2017. 90(3): p. 560-572
    [PMID:28218997]