PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009149435.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 462aa    MW: 51056.7 Da    PI: 5.4713
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009149435.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_122.81.9e-07142204163
                     XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                     e+e +r rr   NRe+Ar   +R++a +eeL +k++ L  eN+ L+ e +   ke ++l++ +
  XP_009149435.1 142 EREERRIRRILANRESARQTIRRRQAMCEELSKKAADLAYENENLRREKDWALKEFQSLETIN 204
                     78899*******************************************999999999988766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF001703.6E-7142204IPR004827Basic-leucine zipper domain
SMARTSM003381.9E-8142206IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.933144207IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.38E-6146201No hitNo description
Gene3DG3DSA:1.20.5.1703.0E-6146212No hitNo description
CDDcd147025.57E-12152198No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 462 aa     Download sequence    Send to blast
MELEPISSCC STSSSGEDAA ANMTELEAAE ALADLAQLAV MREQVFESAA SWGSKGKRVR  60
KRVKTESPPA DSETLPTPDL AEERAVKEEG VEEVEPISRE VTEVPVKTET NGETPKPNLA  120
STLRCNRPSG CGRSRQNLSE AEREERRIRR ILANRESARQ TIRRRQAMCE ELSKKAADLA  180
YENENLRREK DWALKEFQSL ETINKHLKEQ VAKSVKPETK EPEESPKASQ VEMSTSSTTP  240
FYFYNQNPYQ LFCWPHVTQP SNPMVSPLES QNGFTAPFTA TGGASAKAMT SQENGNPGGD  300
DNGQKTHFYV VPCPWFLPAP SDQSNGVPFA FEEPQRVVSS NGHHTDDSST KPVEVTKTPT  360
GIKEENSGST ETRPLYDLNE SAAEVLSEEG DGFPVTTQQQ AFSFKREDVS DSPNGVTPPG  420
HRVLMSLPGK KQGSLAAAEA RKRRKELTKL KNLHGRQCRM QV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1440445RKRRKE
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_009149435.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893560.0AC189356.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB043O20, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009149435.10.0PREDICTED: uncharacterized protein LOC103872751
TrEMBLM4EAD50.0M4EAD5_BRARP; Uncharacterized protein
STRINGBra025743.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM112112428
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19490.11e-178bZIP family protein