PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009148852.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family BBR-BPC
Protein Properties Length: 269aa    MW: 30139.3 Da    PI: 10.2115
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009148852.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind332.71e-10112691301
       GAGA_bind   1 mdddgsrernkgyyepa.aslkenlglqlmssiaerdaki....rernlalsekkaavaerd.....maflqrdkalaernkalverdnkllall 85 
                     mdddg+  rn+gyyepa a++k nlglqlm si +r++k+    r+ nl +++++++++++      m++    +++++       +++k++++l
  XP_009148852.1   1 MDDDGF--RNWGYYEPAaATFKGNLGLQLMPSI-DRNTKPfltgRDPNL-MIGQNGPYHHHPeppinMSY----NWINQ-------HKDKFFNML 80 
                     99**99..9*******999**************.9**************.**********9988888888....*****.......789****** PP

       GAGA_bind  86 lvenslasalpvgvqvlsgtksidslqqlsepqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkksekskkkvkk 180
                     +v+++     p++ ++l++t+s+ s+++   +q++d+  +++       +++ee ++++k++k +  ++ ++++k+kk +k+k++s+ks      
  XP_009148852.1  81 PVTTT-----PNYGNILPETSSAPSMRH---HQTTDEYPGTH-------EQVEEIVQTNKKRKPN--TKPGATTKAKKPRKPKEESDKS------ 152
                     *9986.....9***********997766...56666666632.......2333433333333333..4667888888888888843222...... PP

       GAGA_bind 181 esaderskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaae 275
                          ++k  kks+d+v+ngv++D+s+lPvPvC+CtGa++qCY+WG+GGWqSaCCtt+iS++PLP+stkrrgaRi+grKmSqgafkk+LekLa++
  XP_009148852.1 153 ----IKAKPAKKSVDFVINGVNMDISGLPVPVCTCTGAPQQCYRWGCGGWQSACCTTNISMHPLPMSTKRRGARISGRKMSQGAFKKVLEKLASD 243
                     ....2468899************************************************************************************ PP

       GAGA_bind 276 GydlsnpvDLkdhWAkHGtnkfvtir 301
                     G++++np+DLk+hWA+HGtnkfvtir
  XP_009148852.1 244 GFNFGNPIDLKSHWARHGTNKFVTIR 269
                     *************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF062171.7E-931269IPR010409GAGA-binding transcriptional activator
SMARTSM012261.9E-1581269IPR010409GAGA-binding transcriptional activator
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MDDDGFRNWG YYEPAAATFK GNLGLQLMPS IDRNTKPFLT GRDPNLMIGQ NGPYHHHPEP  60
PINMSYNWIN QHKDKFFNML PVTTTPNYGN ILPETSSAPS MRHHQTTDEY PGTHEQVEEI  120
VQTNKKRKPN TKPGATTKAK KPRKPKEESD KSIKAKPAKK SVDFVINGVN MDISGLPVPV  180
CTCTGAPQQC YRWGCGGWQS ACCTTNISMH PLPMSTKRRG ARISGRKMSQ GAFKKVLEKL  240
ASDGFNFGNP IDLKSHWARH GTNKFVTIR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bra.75890.0root
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, leaves and pistils. Detected in the base of flowers and tips of carpels, in sepal and petal vasculature, in pollen grains, in young rosette, in the lateral and tip of primary roots, and in ovule at the exception of the outer integument. {ECO:0000269|PubMed:14731261, ECO:0000269|PubMed:21435046}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes. {ECO:0000269|PubMed:14731261}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_009148852.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1894990.0AC189499.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB086M23, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009148852.10.0PREDICTED: protein BASIC PENTACYSTEINE2-like isoform X2
RefseqXP_013641431.10.0protein BASIC PENTACYSTEINE2-like
SwissprotQ9LDE21e-156BPC2_ARATH; Protein BASIC PENTACYSTEINE2
TrEMBLA0A078I3340.0A0A078I334_BRANA; BnaA06g09500D protein
STRINGBra026196.1-P0.0(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14685.31e-153basic pentacysteine 2
Publications ? help Back to Top
  1. Brand LH,Kirchler T,Hummel S,Chaban C,Wanke D
    DPI-ELISA: a fast and versatile method to specify the binding of plant transcription factors to DNA in vitro.
    Plant Methods, 2010. 6: p. 25
    [PMID:21108821]
  2. Simonini S,Kater MM
    Class I BASIC PENTACYSTEINE factors regulate HOMEOBOX genes involved in meristem size maintenance.
    J. Exp. Bot., 2014. 65(6): p. 1455-65
    [PMID:24482368]