PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009148750.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GRF
Protein Properties Length: 354aa    MW: 40195.3 Da    PI: 8.8829
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009148750.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC76.62.4e-24127171145
             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                     d+epgrC+RtDGKkWRCsr+v++ +k+C+rH+hrgr+rsrk++e+
  XP_009148750.1 127 DPEPGRCKRTDGKKWRCSRDVVASYKYCDRHIHRGRNRSRKPVET 171
                     79****************************************996 PP

2QLQ51.82.5e-185994237
             QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                     F+ aQ+q+L+ Q+l+y+y++a++ vP+eLl++i+k
  XP_009148750.1 59 LFSLAQWQELELQALIYRYMLAGASVPQELLLPIKK 94
                    59********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009512.2E-105894IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166620.5155994IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088804.6E-136092IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.504127171IPR014977WRC domain
PfamPF088797.0E-21128170IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MSQKNKAMQL RCPSLSPIRF NLKLQLLLLL YLSLFLNPPL LHPSHVSLLI LPRLEMGNLF  60
SLAQWQELEL QALIYRYMLA GASVPQELLL PIKKSLFHQS HLNFLHYPLQ HNFPHHQPWY  120
WGRGAVDPEP GRCKRTDGKK WRCSRDVVAS YKYCDRHIHR GRNRSRKPVE TTTNAATNAA  180
SSFALGEKLG QGPDNLFFSS SSSHSSTQHL HLNSHQSCSS EMKQESNNKK RPYEAHNNGR  240
TNDGHILRHF FEDWPQSSDS TSRPMSSSTC HHSISMPSYA SSDVSLKLST CNEEEEANMI  300
NNNNNEKEHQ QNMNCLSSGG NDYNMDGPLA EALRSASPTS SLLQQMGIST QIFR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1026371e-106AY102637.1 Arabidopsis thaliana transcription activator (GRF4) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009148750.10.0PREDICTED: growth-regulating factor 4-like isoform X2
SwissprotQ8L8A71e-135GRF4_ARATH; Growth-regulating factor 4
TrEMBLA0A078CJM80.0A0A078CJM8_BRANA; BnaA04g05130D protein
STRINGBra019640.1-P0.0(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52910.11e-113growth-regulating factor 4