PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009148749.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GRF
Protein Properties Length: 370aa    MW: 41807.3 Da    PI: 8.0665
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009148749.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC76.62.6e-24143187145
             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                     d+epgrC+RtDGKkWRCsr+v++ +k+C+rH+hrgr+rsrk++e+
  XP_009148749.1 143 DPEPGRCKRTDGKKWRCSRDVVASYKYCDRHIHRGRNRSRKPVET 187
                     79****************************************996 PP

2QLQ51.72.7e-1875110237
             QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                      F+ aQ+q+L+ Q+l+y+y++a++ vP+eLl++i+k
  XP_009148749.1  75 LFSLAQWQELELQALIYRYMLAGASVPQELLLPIKK 110
                     59********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009512.2E-1074110IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166620.51575110IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088804.8E-1376108IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.504143187IPR014977WRC domain
PfamPF088797.5E-21144186IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
MDLQLKQWRI QQQNESEEQS YATKMSKSFS HQIQSQTATS ATALPLFVPE PTTSSSFSCF  60
SPDSSSSRLL KMGNLFSLAQ WQELELQALI YRYMLAGASV PQELLLPIKK SLFHQSHLNF  120
LHYPLQHNFP HHQPWYWGRG AVDPEPGRCK RTDGKKWRCS RDVVASYKYC DRHIHRGRNR  180
SRKPVETTTN AATNAASSFA LGEKLGQGPD NLFFSSSSSH SSTQHLHLNS HQSCSSEMKQ  240
ESNNKKRPYE AHNNGRTNDG HILRHFFEDW PQSSDSTSRP MSSSTCHHSI SMPSYASSDV  300
SLKLSTCNEE EEANMINNNN NEKEHQQNMN CLSSGGNDYN MDGPLAEALR SASPTSSLLQ  360
QMGISTQIFR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009148749.10.0PREDICTED: growth-regulating factor 4-like isoform X1
RefseqXP_013721711.10.0PREDICTED: growth-regulating factor 4-like
SwissprotQ8L8A71e-155GRF4_ARATH; Growth-regulating factor 4
TrEMBLA0A078CJM80.0A0A078CJM8_BRANA; BnaA04g05130D protein
TrEMBLM4DSZ70.0M4DSZ7_BRARP; Uncharacterized protein
STRINGBra019640.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19262667
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52910.11e-130growth-regulating factor 4