PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009148484.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GeBP
Protein Properties Length: 328aa    MW: 35712.1 Da    PI: 6.9772
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009148484.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF5731185e-37107198297
          DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiW 96 
                     +fqr+wseeDei++LqGlid++++tg+sp+dd++afy  vkksisf+vsk+q+++Ki  LK K++++  k     e +fsk+hd+k+f+lsk +W
  XP_009148484.1 107 YFQRVWSEEDEIAVLQGLIDYRNHTGASPYDDTNAFYLSVKKSISFDVSKTQVIKKIWGLKTKYENNLGK----GELTFSKPHDRKAFDLSKFVW 197
                     79********************************************************************....899****************** PP

          DUF573  97 g 97 
                     g
  XP_009148484.1 198 G 198
                     8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045049.3E-32108198IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MSGKRFNPLE DPPSASSSDE DDQVKTASLA GDSSSEEETD DESSLKSAPE KHQASDSDSG  60
SDEKNPGTKD SAVVKKNHDS KKVKPLTKKR SLSERDGAAS KEAKKTYFQR VWSEEDEIAV  120
LQGLIDYRNH TGASPYDDTN AFYLSVKKSI SFDVSKTQVI KKIWGLKTKY ENNLGKGELT  180
FSKPHDRKAF DLSKFVWGAD GAALDSAVKS NGKSKKSSKS KVEPEKVALD SANGKSKKSS  240
KSSSKKVEPE KQELASSSSP NGKSCEEEAM TNKGEASSVV EVDAFDKSVL VKALARFGVD  300
DLSAQRGWSR LALEDKKRFE EEXESVAA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009148484.10.0PREDICTED: LOW QUALITY PROTEIN: mediator-associated protein 1
TrEMBLM4DTK40.0M4DTK4_BRARP; Uncharacterized protein
STRINGBra019847.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G11510.12e-49DNA-binding storekeeper protein-related transcriptional regulator