PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009148228.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family CPP
Protein Properties Length: 646aa    MW: 71198.7 Da    PI: 5.5691
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009148228.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.73.7e-16359397240
             TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     ++k+CnCkkskClk+YCeCfaag++C e C+C dC+Nk 
  XP_009148228.1 359 SCKRCNCKKSKCLKLYCECFAAGVYCIEPCSCIDCFNKP 397
                     689**********************************96 PP

2TCR52.69e-17444482139
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                     ++k+gCnCkks+ClkkYCeCf+ g+ Cs +C+Ce+CkN 
  XP_009148228.1 444 RHKRGCNCKKSNCLKKYCECFQGGVGCSINCRCEGCKNA 482
                     589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.3E-19358399IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.245359484IPR005172CRC domain
PfamPF036386.1E-12361396IPR005172CRC domain
SMARTSM011142.1E-17444485IPR033467Tesmin/TSO1-like CXC domain
PfamPF036383.8E-12446482IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 646 aa     Download sequence    Send to blast
MDTPQKSITQ IETPVSKSRF EDSPVFNYIN SLSPIRPVKS IPNPHQFSTL NFTSPPSVFT  60
SPHLTSSHKE SRFFKTHHPS PDPTILVQES PDDSKSNEEA AAEADATTEF NIDASTEMEQ  120
PQIVKYDVKE TNLDETTDLS LVPYASPPRK ENGSASEDAP GMEMYDNVQG KNETPDWDRL  180
IADSSEFLIF SSPNDSEAFR CLMMQRASPS QAPSVMMPTM QPGSINEPES SNASPYGAVS  240
VLHRGIRRRC LDFEMPGNKQ TSSENNTASR CVVPSIGLHL NALLMSTKDC TTNNTTHDYS  300
CSEKYQVGLQ GSSSTLQETL DQTETETRED VPVEPTLEEL HLSSPKKKRV KLEAGEGESC  360
KRCNCKKSKC LKLYCECFAA GVYCIEPCSC IDCFNKPIHE DTVLATRKQI ESRNPLAFAP  420
KVIKSSDLVL ETGDDASKTP ASARHKRGCN CKKSNCLKKY CECFQGGVGC SINCRCEGCK  480
NAFGRKDGSA IVDMEAEQEE ENETSVKNRR AKTQENSEVY LMRKEESSAL PATPMSVYRQ  540
QLVQLKNMMP PPQSVLGVGS SSSGMFNSQY TRKPEMKSLE TVAEDGAEEM PEILSHSSID  600
NINAVSPNGK RVSPPHLDSS SSGRRSGGRK LILQSIPTFP SLTPQH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A1e-1636348114120Protein lin-54 homolog
5fd3_B1e-1636348114120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1344351PKKKRVKL
2344352PKKKRVKLE
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed at the late stage of pollen development in tricellular and mature pollen. {ECO:0000269|PubMed:18057042}.
UniprotTISSUE SPECIFICITY: Ubiquitous but expressed mostly in all the aerial organs with highest expression in flowers. {ECO:0000269|PubMed:10769245, ECO:0000269|PubMed:18057042}.
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00433DAPTransfer from AT4G14770Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_009148228.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009148228.10.0PREDICTED: protein tesmin/TSO1-like CXC 2
SwissprotF4JIF50.0TCX2_ARATH; Protein tesmin/TSO1-like CXC 2
TrEMBLM4F7400.0M4F740_BRARP; Uncharacterized protein
STRINGBra036900.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14672891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.10.0TESMIN/TSO1-like CXC 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]