PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009148047.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family NF-YC
Protein Properties Length: 177aa    MW: 20110.7 Da    PI: 8.9848
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009148047.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC45.71.4e-14731591399
           NF-YC  13 atdfknhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprd 99 
                     ++d k  ++P+ ri++i+++d+   +i  +a  l+ ka elfi  ++  ++  + + k++ ++   ++++v++ + ++fl d vp++
  XP_009148047.1  73 SEDAKMVRFPMNRIRRIMRSDNSAPQIMQDAVFLVNKATELFIERFSEEAYGSSVQDKKKFIHYKHLSSVVSNEERYEFLADCVPEK 159
                     56889999****************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF008089.3E-2180143IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
SuperFamilySSF471139.88E-1980163IPR009072Histone-fold
Gene3DG3DSA:1.10.20.106.0E-2481158IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 177 aa     Download sequence    Send to blast
MVSSKKPNQE KKPKNGDGLN TRSSGSKTKK KTPNKAKLKD VAEKEPEVHE ISESSSSEGR  60
RDEPKESNGV VVSEDAKMVR FPMNRIRRIM RSDNSAPQIM QDAVFLVNKA TELFIERFSE  120
EAYGSSVQDK KKFIHYKHLS SVVSNEERYE FLADCVPEKL KGEVALEEWE RSMTDVG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC7971471e-104KC797147.1 Brassica napus transcription factor subunit NF-YC10B (NF-YC10B) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009148047.11e-127PREDICTED: chromatin accessibility complex protein 1
RefseqXP_013646475.11e-127PREDICTED: chromatin accessibility complex protein 1-like
TrEMBLM4DQ751e-127M4DQ75_BRARP; Uncharacterized protein
STRINGBra018668.1-P1e-127(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM111902231
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07980.13e-65nuclear factor Y, subunit C10